Comparing AZOBR_RS26370 FitnessBrowser__azobra:AZOBR_RS26370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
34% identity, 96% coverage: 8:250/254 of query aligns to 18:259/261 of 2xuaH
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
28% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 2d0dA
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
29% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
29% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
29% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
29% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
29% identity, 94% coverage: 11:250/254 of query aligns to 21:268/271 of 1iupA
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
33% identity, 90% coverage: 4:232/254 of query aligns to 10:245/268 of 6eb3B
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
28% identity, 94% coverage: 11:250/254 of query aligns to 22:269/276 of 1iunB
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 90% coverage: 4:232/254 of query aligns to 10:239/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 90% coverage: 4:232/254 of query aligns to 10:242/265 of 6eb3A
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 98% coverage: 4:253/254 of query aligns to 16:270/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 98% coverage: 4:253/254 of query aligns to 16:270/278 of 4uhfA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 98% coverage: 4:253/254 of query aligns to 16:270/274 of 4uhdA
4ccwA Crystal structure of naproxen esterase (carboxylesterase np) from bacillus subtilis (see paper)
25% identity, 93% coverage: 15:250/254 of query aligns to 49:284/285 of 4ccwA
P46541 Proline iminopeptidase; PIP; Prolyl aminopeptidase; PAP; EC 3.4.11.5 from Heyndrickxia coagulans (Weizmannia coagulans) (see paper)
23% identity, 96% coverage: 10:253/254 of query aligns to 22:288/288 of P46541
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
25% identity, 94% coverage: 11:250/254 of query aligns to 30:282/285 of 2og1A
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
25% identity, 94% coverage: 11:250/254 of query aligns to 31:283/286 of P47229
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
23% identity, 94% coverage: 11:250/254 of query aligns to 23:273/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
23% identity, 94% coverage: 11:250/254 of query aligns to 23:273/276 of 4lxiA
>AZOBR_RS26370 FitnessBrowser__azobra:AZOBR_RS26370
MAQHLAVEVHGAGDPVILIHGLGGTSNVFTPQVGALSRFFQCVRFDLPGSGRSAITDDVS
ISGFVDAVVAVLDSRGIERAHVVGHSLGTVVCQHLAIRQPERVRSLSLIGPLHAPPEAAR
PALRDRAAKARADGMVGIADAVVQGGTSADTKANRPEVAAFVREILMRQDPEGYARTCEA
LAAAEPADVARIACPTLLITGDEDGTAPPPAVRALASKIPGSNLRILDRCGHWTTFERPA
AVNEALVNFLFSVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory