Comparing AZOBR_RS26420 FitnessBrowser__azobra:AZOBR_RS26420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
29% identity, 83% coverage: 47:403/432 of query aligns to 21:341/373 of 4v15A
Sites not aligning to the query:
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
26% identity, 86% coverage: 43:413/432 of query aligns to 23:364/384 of 6qkbA
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
26% identity, 86% coverage: 43:413/432 of query aligns to 26:367/387 of A1B8Z1
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
29% identity, 47% coverage: 43:245/432 of query aligns to 20:220/398 of 7yqaB
Sites not aligning to the query:
>AZOBR_RS26420 FitnessBrowser__azobra:AZOBR_RS26420
MSVFLDALLDSSLDDSIRGVPPGTAPLRLRDVGARGWRPAAGDMALPVLTLDEDAFAANR
DLIFAYARRHGVALAPHAKTPMAPQIASALVEAGAWGATVANLQQAAVLLRAGVTRLILA
NEIGGRASGERLGALLASHPDADLRAFADSPAAVETLAAAARAAGRPPERPLPVLVEVGA
GRAGARDRAAVDAILAAVVRHPGLLVLDGIATYEGAVATADPAETAANIAALMRRTAEAF
ALVRALAPERPLLLTAGGSAFFDMVVAGLAPVAATDGNATLVLRSGAIFFHDHGVYERAL
GALDARQGFACGGATAADFRPALRLWAEVLTRPEPELAICGFGMRDASFDQGLPRPLRVH
RDGTALSAEGLRVTRLNDQHAFVAVPAGHDLAVGDIVELGISHPCTCIDRWRVLFGLGAD
GRVRSAYRTFFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory