Comparing AZOBR_RS26490 FitnessBrowser__azobra:AZOBR_RS26490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
41% identity, 97% coverage: 9:323/324 of query aligns to 9:329/331 of 6cerD
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
41% identity, 97% coverage: 9:323/324 of query aligns to 8:328/330 of 6cfoB
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
41% identity, 97% coverage: 9:323/324 of query aligns to 37:357/359 of P11177
Sites not aligning to the query:
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
45% identity, 98% coverage: 8:323/324 of query aligns to 6:321/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
45% identity, 98% coverage: 8:323/324 of query aligns to 6:321/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
45% identity, 98% coverage: 8:323/324 of query aligns to 6:321/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
45% identity, 98% coverage: 8:323/324 of query aligns to 7:322/324 of Q5SLR3
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
41% identity, 98% coverage: 8:323/324 of query aligns to 6:322/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
41% identity, 98% coverage: 8:323/324 of query aligns to 6:322/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
41% identity, 98% coverage: 8:323/324 of query aligns to 6:322/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
41% identity, 98% coverage: 8:323/324 of query aligns to 6:322/324 of 1w85B
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
38% identity, 98% coverage: 8:323/324 of query aligns to 8:336/338 of 1qs0B
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
35% identity, 99% coverage: 3:323/324 of query aligns to 6:327/329 of 2j9fD
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
35% identity, 99% coverage: 3:323/324 of query aligns to 3:324/326 of 1dtwB
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
35% identity, 99% coverage: 3:323/324 of query aligns to 69:390/392 of P21953
8a45F Structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with 2-acetyl thiamine diphosphate (see paper)
28% identity, 79% coverage: 51:305/324 of query aligns to 314:553/573 of 8a45F
Sites not aligning to the query:
8a5kA Structural analysis of 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa and klebsiella pneumoniae reveals conformational changes upon cofactor binding (see paper)
28% identity, 79% coverage: 51:305/324 of query aligns to 303:542/562 of 8a5kA
Sites not aligning to the query:
8a4dA 1-deoxy-d-xylulose 5-phosphate synthase from pseudomonas aeruginosa with a thiamine analog inhibitor (see paper)
28% identity, 79% coverage: 51:305/324 of query aligns to 303:542/564 of 8a4dA
Sites not aligning to the query:
6yakDDD C-terminal component of the split chain transketolase (see paper)
27% identity, 84% coverage: 51:323/324 of query aligns to 44:307/311 of 6yakDDD
Sites not aligning to the query:
8bzxB 1-deoxy-d-xylulose 5-phosphate synthase from klebsiella pneumoniae (kpdxps),co-crystal with thiamine monophosphate analog (see paper)
25% identity, 85% coverage: 51:324/324 of query aligns to 308:568/568 of 8bzxB
Sites not aligning to the query:
>AZOBR_RS26490 FitnessBrowser__azobra:AZOBR_RS26490
MPKPLRYVNAVAQALNDAMAADPAVMLMGEDVAAAGGPFKATRGLLDAHGPERVRDTPIS
EASLVGAAVGAALTGMKPVVEIMFMDFVTLAMDAVVNQAAKARFMFGGQCSVPMVLRTPH
GGGLNAGPQHSQCLEAWFAHIPGLRVVCPATVADAYSLLRAAIEAPDPVVVVENKALYAL
QGDIDVNAPREVGKARIDRAGRDATIVTYGATLYAARAAADRLATEGIEAEIVDLRWIQP
WDEEAVFASVAKTHRVVIAHEAVQAFGVGAEIAARIAADAFDDLDAPVLRVGAPFMPIAF
AKTLEAAYLPDADRIVAAVKSTLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory