SitesBLAST
Comparing AZOBR_RS26635 FitnessBrowser__azobra:AZOBR_RS26635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
42% identity, 98% coverage: 1:386/393 of query aligns to 1:373/378 of 4hpnA
- active site: F19 (= F20), G50 (= G53), R53 (≠ E56), T134 (= T138), K164 (= K172), K166 (= K174), D194 (= D203), N196 (= N205), E220 (= E229), G245 (= G254), E246 (= E255), T247 (≠ C256), Q267 (= Q276), D269 (= D278), H296 (= H305), V297 (≠ I306), W298 (= W307), R320 (≠ L331), E329 (= E342), F330 (= F343), H334 (= H347)
- binding calcium ion: D194 (= D203), D209 (≠ R218), E220 (= E229), G237 (≠ S246), E246 (= E255)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
41% identity, 98% coverage: 3:386/393 of query aligns to 3:348/351 of 5olcC
- active site: K148 (= K172), K150 (= K174), D178 (= D203), N180 (= N205), E204 (= E229), G229 (= G254), E230 (= E255), D253 (= D278), H280 (= H305), E304 (= E342), E309 (≠ H347)
- binding magnesium ion: D178 (= D203), E204 (= E229), E230 (= E255)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
31% identity, 92% coverage: 30:389/393 of query aligns to 25:373/373 of 3sjnA
- active site: S46 (vs. gap), L49 (vs. gap), T139 (= T138), K165 (= K172), G167 (≠ K174), M171 (≠ L178), D198 (= D203), A200 (≠ N205), E225 (= E229), I247 (= I251), G250 (= G254), E251 (= E255), S252 (≠ C256), Q272 (= Q276), D274 (= D278), H301 (= H305), G302 (≠ I306), F303 (≠ W307), M325 (≠ V341), E326 (= E342), Q329 (≠ R345), S331 (≠ H347)
- binding magnesium ion: D198 (= D203), E225 (= E229), E251 (= E255)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
34% identity, 98% coverage: 1:386/393 of query aligns to 1:366/376 of 3bjsB
- active site: V18 (≠ K18), P49 (= P54), S52 (≠ P57), L93 (≠ Q94), G136 (≠ T138), K164 (= K172), R166 (≠ K174), D194 (= D203), N196 (= N205), E220 (= E229), G246 (= G254), E247 (= E255), N248 (≠ C256), Q268 (= Q276), D270 (= D278), H297 (= H305), S298 (≠ I306), S299 (≠ W307), E322 (≠ A330), C324 (≠ G332), K327 (≠ T346)
- binding magnesium ion: D194 (= D203), E220 (= E229), E247 (= E255)
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
32% identity, 100% coverage: 1:393/393 of query aligns to 2:379/381 of 3ozmD
- active site: M20 (≠ T19), G53 (= G50), D56 (≠ G53), S143 (≠ T138), K170 (= K172), K172 (= K174), D200 (= D203), N202 (= N205), E226 (= E229), G252 (= G254), E253 (= E255), N254 (≠ C256), Q274 (= Q276), D276 (= D278), H303 (= H305), T304 (≠ I306), F305 (≠ W307), E328 (= E342), I331 (≠ R345), H333 (= H347)
- binding L-arabinaric acid: K172 (= K174), D200 (= D203), N202 (= N205), E253 (= E255), H303 (= H305), F305 (≠ W307), E328 (= E342)
- binding magnesium ion: D200 (= D203), E226 (= E229), E253 (= E255)
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
32% identity, 100% coverage: 1:393/393 of query aligns to 2:379/386 of 3ozmA
- active site: M20 (≠ T19), G53 (= G50), D56 (≠ G53), S143 (≠ T138), K170 (= K172), K172 (= K174), D200 (= D203), N202 (= N205), E226 (= E229), G252 (= G254), E253 (= E255), N254 (≠ C256), Q274 (= Q276), D276 (= D278), H303 (= H305), T304 (≠ I306), F305 (≠ W307), E328 (= E342), I331 (≠ R345), H333 (= H347)
- binding D-xylaric acid: S24 (= S23), K29 (≠ P28), Y146 (= Y141), K170 (= K172), K172 (= K174), D200 (= D203), N202 (= N205), E253 (= E255), H303 (= H305), F305 (≠ W307), E328 (= E342)
- binding magnesium ion: D200 (= D203), E226 (= E229), E253 (= E255)
3n4eA Crystal structure of mandelate racemase/muconate lactonizing protein from paracoccus denitrificans pd1222
34% identity, 90% coverage: 31:384/393 of query aligns to 17:358/368 of 3n4eA
- active site: S124 (≠ T138), K153 (= K172), R155 (≠ K174), V165 (≠ L178), D190 (= D203), N192 (= N205), E216 (= E229), G241 (= G254), E242 (= E255), Q262 (= Q276), D264 (= D278), H291 (= H305), Q292 (≠ I306), T293 (≠ W307), G296 (= G310), P315 (≠ G332), V316 (= V333), E317 (≠ P334), L318 (= L335), R324 (= R345)
- binding calcium ion: D190 (= D203), E216 (= E229), E242 (= E255), V352 (= V378), E354 (≠ P380)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
32% identity, 100% coverage: 1:393/393 of query aligns to 2:374/375 of 3op2A
- active site: M20 (≠ T19), G53 (= G50), D56 (≠ G53), S138 (≠ T138), K165 (= K172), K167 (= K174), D195 (= D203), N197 (= N205), E221 (= E229), G247 (= G254), E248 (= E255), N249 (≠ C256), Q269 (= Q276), D271 (= D278), H298 (= H305), T299 (≠ I306), F300 (≠ W307), E323 (= E342), I326 (≠ R345), H328 (= H347)
- binding 2-oxoglutaric acid: K165 (= K172), K167 (= K174), D195 (= D203), E248 (= E255), H298 (= H305), E323 (= E342)
- binding magnesium ion: D195 (= D203), E221 (= E229), E248 (= E255)
4h83F Crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127)
29% identity, 99% coverage: 1:388/393 of query aligns to 2:367/368 of 4h83F
- active site: F20 (= F20), D51 (≠ G50), I139 (≠ T138), K166 (= K172), K168 (= K174), I196 (≠ V202), D197 (= D203), A198 (= A204), N199 (= N205), E223 (= E229), G249 (= G254), Q250 (≠ E255), N271 (≠ Q276), D273 (= D278), H300 (= H305), E301 (≠ T322), E302 (≠ A323), E320 (≠ V341), D325 (≠ T346)
- binding bicarbonate ion: R220 (= R226), I318 (≠ P339)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
30% identity, 98% coverage: 2:388/393 of query aligns to 1:357/357 of 3ck5A
- active site: T19 (≠ F20), T50 (≠ Q51), G137 (≠ T138), K164 (= K172), K166 (= K174), D195 (= D203), N197 (= N205), I220 (≠ F228), E221 (= E229), I243 (= I251), G246 (= G254), E247 (= E255), E268 (≠ Q276), D270 (= D278), H297 (= H305), G298 (= G310), V299 (≠ I311), Y315 (= Y328), E317 (≠ A330)
- binding magnesium ion: D195 (= D203), E221 (= E229), E247 (= E255)
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
31% identity, 98% coverage: 2:388/393 of query aligns to 1:360/361 of Q9RKF7
- D195 (= D203) binding
- E221 (= E229) binding
- E247 (= E255) binding
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
29% identity, 99% coverage: 3:391/393 of query aligns to 5:365/367 of 5xd8B
- active site: S22 (≠ F20), T53 (≠ Q51), G140 (≠ T138), K167 (= K172), K169 (= K174), D198 (= D203), N200 (= N205), E224 (= E229), G249 (= G254), E250 (= E255), Q271 (= Q276), D273 (= D278), H300 (= H305), G301 (≠ A316), M302 (≠ L317), W317 (≠ G332), E319 (≠ P334), P324 (= P339)
- binding magnesium ion: D198 (= D203), E224 (= E229), E250 (= E255)
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
31% identity, 88% coverage: 33:378/393 of query aligns to 23:378/397 of 2ox4C
- active site: K165 (= K172), D167 (≠ K174), E214 (≠ D203), H216 (≠ N205), E240 (= E229), G265 (= G254), E266 (= E255), Q287 (= Q276), D289 (= D278), H316 (= H305), E341 (= E342)
- binding magnesium ion: E214 (≠ D203), E240 (= E229), E266 (= E255)
3no1A Crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
28% identity, 99% coverage: 1:388/393 of query aligns to 1:355/355 of 3no1A
- active site: D39 (≠ G50), I127 (≠ T138), K154 (= K172), K156 (= K174), I184 (≠ V202), D185 (= D203), A186 (= A204), N187 (= N205), E211 (= E229), G237 (= G254), Q238 (≠ E255), N259 (≠ Q276), D261 (= D278), H288 (= H305), E289 (≠ T322), E290 (≠ A323), E308 (≠ V341), D313 (≠ T346)
- binding magnesium ion: D185 (= D203), E211 (= E229), Q238 (≠ E255)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
32% identity, 90% coverage: 32:385/393 of query aligns to 59:391/395 of 3ekgA
- active site: K178 (≠ A155), P180 (≠ A157), G184 (≠ A160), S186 (≠ R162), E190 (≠ A166), D215 (= D203), W217 (≠ N205), E241 (= E229), T266 (≠ A252), G268 (= G254), E269 (= E255), Q290 (= Q276), D292 (= D278), H319 (= H305), E339 (≠ P327), D348 (≠ N337)
- binding magnesium ion: D215 (= D203), E241 (= E229), E269 (= E255)
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
32% identity, 91% coverage: 30:385/393 of query aligns to 21:375/397 of 3rcyF
- active site: K165 (= K172), D167 (vs. gap), R175 (≠ K174), G208 (≠ D203), H210 (≠ N205), E234 (= E229), G259 (= G254), E260 (= E255), Q281 (= Q276), A283 (≠ D278), H310 (= H305), A313 (≠ G308), L332 (≠ P339), E335 (= E342)
- binding magnesium ion: E234 (= E229), E260 (= E255)
- binding alpha-D-ribofuranose: R85 (≠ K95), P86 (≠ G96), P239 (= P234), A266 (≠ Y261), E267 (≠ G262)
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
31% identity, 96% coverage: 11:387/393 of query aligns to 37:385/395 of 2pp1A
- active site: K45 (= K18), S78 (vs. gap), K192 (= K172), K194 (= K174), D223 (= D203), N225 (= N205), E249 (= E229), G274 (= G254), E275 (= E255), D298 (= D278), H325 (= H305), E345 (= E342)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (≠ N16), K45 (= K18), K79 (vs. gap), F168 (= F146), K194 (= K174), E275 (= E255), H325 (= H305), E345 (= E342)
- binding magnesium ion: D223 (= D203), E249 (= E229), E275 (= E255)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 96% coverage: 11:387/393 of query aligns to 40:388/398 of Q8ZL58
- DAK 46:48 (≠ NAK 16:18) binding
- KR 82:83 (vs. gap) binding
- K195 (= K172) binding
- K197 (= K174) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D203) binding
- N228 (= N205) binding
- E252 (= E229) binding
- E278 (= E255) binding
- H328 (= H305) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E342) binding
4dn1A Crystal structure of an enolase (mandelate racemase subgroup member) from agrobacterium tumefaciens (target efi-502088) with bound mg and formate
35% identity, 88% coverage: 32:376/393 of query aligns to 53:376/389 of 4dn1A
- active site: F181 (≠ L168), A183 (= A170), K185 (= K172), A187 (≠ K174), A213 (≠ M201), D215 (= D203), H217 (≠ N205), E241 (= E229), G266 (= G254), E267 (= E255), Q288 (= Q276), P289 (= P277), E290 (≠ D278), H316 (= H305), T318 (≠ I306), E342 (= E342)
- binding magnesium ion: D215 (= D203), E241 (= E229), E267 (= E255)
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
31% identity, 96% coverage: 11:387/393 of query aligns to 37:385/395 of 2pp3A
- active site: K45 (= K18), S78 (vs. gap), K192 (= K172), A194 (≠ K174), D223 (= D203), N225 (= N205), E249 (= E229), G274 (= G254), E275 (= E255), D298 (= D278), H325 (= H305), E345 (= E342)
- binding l-glucaric acid: D43 (≠ N16), K79 (vs. gap), K192 (= K172), D223 (= D203), N225 (= N205), E275 (= E255), H325 (= H305), E345 (= E342), F347 (≠ D344)
- binding magnesium ion: D223 (= D203), E249 (= E229), E275 (= E255)
Query Sequence
>AZOBR_RS26635 FitnessBrowser__azobra:AZOBR_RS26635
MLIKKIDTFVLKTPLNAKTFYSSQAAFPERNSLLVRITTDDGLVGWGEGGQYGPAEPPES
CIIDVLAPRLIGRRADQPVRVFEDLYSFCRDFGQKGTYIEALSAIDIALWDLWGKSLNRP
VHALMGGAFRDKVAAYGTGCYYPDYFRDTPRMMAALAEEAQRYREAGLPAIKIKIGLLPI
AQDIERVALVRDVLGPDTLIMVDANHAYNTAGAIRIGRALERFDVRWFEEPVPPEDRQGY
RRVRDSIDVPIAGGECEYTRYGFRELLAGGCIDIAQPDLCCAGGFTEWQKILALTTAHGV
MTVPHIWGSGIALAAALQALATAPLVPYTALGVPLQNEPMVEFDRTHNPLRDDLLIDNFT
LVDGCLALPGGAGLGVEVDPDQLARYTVRSRSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory