Comparing AZOBR_RS26735 FitnessBrowser__azobra:AZOBR_RS26735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
40% identity, 92% coverage: 5:308/331 of query aligns to 1:309/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 95% coverage: 7:322/331 of query aligns to 4:316/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 95% coverage: 7:322/331 of query aligns to 3:305/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 79% coverage: 6:265/331 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 79% coverage: 6:265/331 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 79% coverage: 6:265/331 of query aligns to 2:247/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 71% coverage: 27:262/331 of query aligns to 14:236/241 of 4u00A
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 63% coverage: 28:234/331 of query aligns to 20:215/226 of 5xu1B
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 72% coverage: 28:264/331 of query aligns to 18:243/343 of P30750
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
36% identity, 64% coverage: 30:241/331 of query aligns to 18:217/223 of 2pclA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 75% coverage: 14:262/331 of query aligns to 29:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 75% coverage: 14:262/331 of query aligns to 29:263/382 of 7aheC
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 72% coverage: 28:264/331 of query aligns to 19:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 72% coverage: 28:264/331 of query aligns to 19:244/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 72% coverage: 28:264/331 of query aligns to 19:244/344 of 6cvlD
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 73% coverage: 6:248/331 of query aligns to 3:229/648 of P75831
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
35% identity, 76% coverage: 7:256/331 of query aligns to 4:229/650 of 5ws4A
7ahdC Opua (e190q) occluded (see paper)
30% identity, 74% coverage: 14:257/331 of query aligns to 29:258/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 72% coverage: 28:265/331 of query aligns to 14:239/240 of 4ymuJ
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
38% identity, 66% coverage: 25:241/331 of query aligns to 16:221/222 of 7arlD
>AZOBR_RS26735 FitnessBrowser__azobra:AZOBR_RS26735
MTATLPLLEVRGLRTELPARQGALNVPLNVLDGVSFSLGRGRILGLVGESGSGKSATAFS
IMGLLDPPARVAGGSIRFAGRELAGLPERELRRLRGNRIAMIFQDPMMTLNPVLTIGAQI
VETVLAHARVGRAEARRRARDALGRVGVPGPEERLDAHPHELSGGLRQRVAIAIALLHEP
DLIIADEPTTALDATIQAQILREIRGLVEGGRTAVLWITHDLSVAEQLSDEIAVMYAGRI
VEQAPAAELLSRPAHPYTAGLLASLPREPRGSRLTPIPGLPPTLSGRPAGCAFRPRCAAA
MPACAAAPPWQGRTDGRGGVRCLDPGPEAPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory