Comparing AZOBR_RS26740 FitnessBrowser__azobra:AZOBR_RS26740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 93% coverage: 21:313/315 of query aligns to 16:307/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 93% coverage: 21:313/315 of query aligns to 17:318/326 of Q8RDH4
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 98% coverage: 4:311/315 of query aligns to 2:321/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 91% coverage: 5:290/315 of query aligns to 1:270/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 91% coverage: 5:290/315 of query aligns to 2:271/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 91% coverage: 5:290/315 of query aligns to 2:271/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 91% coverage: 5:290/315 of query aligns to 2:271/344 of 3tuiC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 80% coverage: 4:254/315 of query aligns to 16:250/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 73% coverage: 25:253/315 of query aligns to 14:237/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
36% identity, 73% coverage: 25:253/315 of query aligns to 16:239/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
36% identity, 73% coverage: 25:253/315 of query aligns to 16:239/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
36% identity, 73% coverage: 25:253/315 of query aligns to 16:239/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
36% identity, 73% coverage: 25:253/315 of query aligns to 16:239/242 of 2oljA
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 72% coverage: 29:255/315 of query aligns to 19:241/253 of 6z5uK
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 77% coverage: 11:252/315 of query aligns to 2:236/241 of 4u00A
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
34% identity, 72% coverage: 29:255/315 of query aligns to 21:243/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
34% identity, 72% coverage: 29:255/315 of query aligns to 21:243/263 of 7d08B
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 80% coverage: 22:274/315 of query aligns to 37:287/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 80% coverage: 22:274/315 of query aligns to 37:287/382 of 7aheC
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 65% coverage: 27:230/315 of query aligns to 19:215/276 of Q5M243
>AZOBR_RS26740 FitnessBrowser__azobra:AZOBR_RS26740
MSPPLAELRGVSRLFPIPGWRGAVLRAVDGVDLAVRRGELVGLVGESGCGKSTVARIATG
LLPPSAGRVLIDGQDAAERPAAEARAARLRVQMVFQNPHASLNPRFTVEEIVGEAVRHHR
LVPRAALAEHVAAQLLRVGLDPALRHHHPHRFSGGQRQRIGIARALAVRPDLLVCDEPVT
ALDVSVRAGILNLFLDLRDRDGLAILFISHDLSVVGHICDRVVVMYLGRVVEEGPVDALF
ERPRHPYTQALLADSRSALPEGTVPVRGEAPSLAERPAGCPFHPRCPMARPDCRREVPVL
RGVGEGHRVACLLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory