SitesBLAST
Comparing AZOBR_RS26915 FitnessBrowser__azobra:AZOBR_RS26915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 30:242/335 of 5a05A
- active site: K100 (≠ I94), Y185 (≠ H178)
- binding beta-D-glucopyranose: K100 (≠ I94), F159 (= F153), D181 (≠ H174), Y185 (≠ H178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ G33), G36 (= G34), T37 (≠ E35), K40 (≠ D38), Y58 (≠ A56), I76 (≠ A70), T77 (= T71), P78 (= P72), N79 (≠ T73), L81 (≠ V75), H82 (= H76), E99 (= E93), K100 (≠ I94), R128 (≠ T122), W167 (= W167), R168 (≠ T168), Y185 (≠ H178)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 30:242/335 of 5a04A
- active site: K100 (≠ I94), Y185 (≠ H178)
- binding beta-D-glucopyranose: K100 (≠ I94), F159 (= F153), R168 (≠ T168), D181 (≠ H174), Y185 (≠ H178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ G33), G36 (= G34), T37 (≠ E35), K40 (≠ D38), Y58 (≠ A56), I76 (≠ A70), T77 (= T71), P78 (= P72), N79 (≠ T73), L81 (≠ V75), H82 (= H76), E99 (= E93), K100 (≠ I94), R128 (≠ T122), W167 (= W167), R168 (≠ T168), Y185 (≠ H178)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 30:242/335 of 5a03E
- active site: K100 (≠ I94), Y185 (≠ H178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ G33), G36 (= G34), T37 (≠ E35), K40 (≠ D38), Y58 (≠ A56), I76 (≠ A70), T77 (= T71), P78 (= P72), N79 (≠ T73), H82 (= H76), E99 (= E93), K100 (≠ I94), R128 (≠ T122), W167 (= W167), R168 (≠ T168), Y185 (≠ H178)
- binding beta-D-xylopyranose: K100 (≠ I94), F159 (= F153), R168 (≠ T168), D181 (≠ H174), Y185 (≠ H178), E205 (≠ Q198), T207 (≠ P200), R209 (vs. gap)
- binding alpha-D-xylopyranose: H134 (≠ S128)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 30:242/335 of 5a02A
- active site: K100 (≠ I94), Y185 (≠ H178)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S35 (≠ G33), G36 (= G34), T37 (≠ E35), K40 (≠ D38), Y58 (≠ A56), I76 (≠ A70), T77 (= T71), P78 (= P72), L81 (≠ V75), H82 (= H76), E99 (= E93), K100 (≠ I94), R128 (≠ T122), W167 (= W167), R168 (≠ T168), Y185 (≠ H178)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
27% identity, 58% coverage: 10:192/315 of query aligns to 16:202/347 of 3q2kC
- active site: K100 (≠ I94), H188 (= H178)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ A11), K100 (≠ I94), W159 (≠ F152), T160 (≠ F153), R161 (= R154), Y165 (≠ M158), N184 (≠ H174), Q185 (≠ H175), H188 (= H178)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G10), R17 (≠ A11), I18 (≠ F12), D40 (≠ G33), T41 (≠ G34), A76 (= A70), T77 (= T71), S79 (≠ T73), H82 (= H76), Q85 (= Q79), E99 (= E93), K100 (≠ I94), Q128 (≠ T122), W171 (≠ P164), R172 (= R165)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 31:243/336 of 5a06A
- active site: K101 (≠ I94), Y186 (≠ H178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ G33), G37 (= G34), T38 (≠ E35), K41 (≠ D38), Y59 (≠ A56), I77 (≠ A70), T78 (= T71), P79 (= P72), N80 (≠ T73), L82 (≠ V75), H83 (= H76), E100 (= E93), K101 (≠ I94), R129 (≠ T122), W168 (= W167), R169 (≠ T168), Y186 (≠ H178)
- binding sorbitol: D72 (≠ E65), H96 (= H89), K101 (≠ I94), R122 (≠ L115), R122 (≠ L115), L124 (≠ A117), F160 (= F153), R169 (≠ T168), D182 (≠ H174), Y186 (≠ H178)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 11, 12, 13, 14, 264
- binding sorbitol: 2, 287, 296, 299, 306, 310, 311
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 64% coverage: 28:230/315 of query aligns to 31:243/336 of 5a03C
- active site: K101 (≠ I94), Y186 (≠ H178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ G33), G37 (= G34), T38 (≠ E35), K41 (≠ D38), Y59 (≠ A56), I77 (≠ A70), T78 (= T71), P79 (= P72), N80 (≠ T73), L82 (≠ V75), H83 (= H76), E100 (= E93), K101 (≠ I94), R129 (≠ T122), W168 (= W167), R169 (≠ T168), Y186 (≠ H178)
- binding beta-D-xylopyranose: K101 (≠ I94), F160 (= F153), R169 (≠ T168), D182 (≠ H174), Y186 (≠ H178)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
27% identity, 58% coverage: 10:192/315 of query aligns to 11:197/322 of 3q2kK
- active site: K95 (≠ I94), H183 (= H178)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ A11), K95 (≠ I94), T155 (≠ F153), R156 (= R154), Y160 (≠ M158), N179 (≠ H174), Q180 (≠ H175), H183 (= H178)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), R12 (≠ A11), I13 (≠ F12), D35 (≠ G33), T36 (≠ G34), T72 (= T71), P73 (= P72), S74 (≠ T73), L76 (≠ V75), H77 (= H76), E94 (= E93), K95 (≠ I94), Q123 (≠ T122), W166 (≠ P164), R167 (= R165), H183 (= H178)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
- binding 1,4-dihydronicotinamide adenine dinucleotide: 9
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
29% identity, 54% coverage: 63:233/315 of query aligns to 64:229/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (= H121), Q173 (≠ H175), H176 (= H178)
- binding nicotinamide-adenine-dinucleotide: A71 (= A70), S72 (≠ T71), P73 (= P72), F76 (≠ V75), Q80 (= Q79), E94 (= E93), K95 (≠ I94), P96 (= P95), R161 (≠ S156), P163 (≠ M158), E164 (≠ N159)
Sites not aligning to the query:
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
28% identity, 56% coverage: 55:229/315 of query aligns to 65:242/345 of 3q2iA
- active site: K104 (≠ I94), H192 (= H178)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (≠ I94), N133 (≠ T122), T164 (≠ F153), R165 (= R154), Y169 (≠ N157), N188 (≠ H174), Q189 (≠ H175), H192 (= H178)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T81 (= T71), P82 (= P72), S83 (≠ T73), H86 (= H76), E103 (= E93), K104 (≠ I94), Q132 (≠ H121), W175 (≠ K163), R176 (≠ P164), H192 (= H178)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 247, 248
- binding 1,4-dihydronicotinamide adenine dinucleotide: 19, 20, 21, 22, 44, 45
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
27% identity, 57% coverage: 10:189/315 of query aligns to 11:187/336 of 3ec7A
- active site: K97 (≠ I94), H176 (= H178)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ A11), I13 (≠ F12), D35 (= D37), I36 (≠ D38), R40 (≠ F42), T73 (≠ A70), A74 (≠ T71), S75 (≠ P72), N76 (≠ T73), H79 (= H76), E96 (= E93), K97 (≠ I94), M126 (≠ T122)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
26% identity, 83% coverage: 52:312/315 of query aligns to 49:336/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (≠ I94), R150 (≠ Q144), W157 (≠ Y151), F160 (≠ R154), D173 (vs. gap), H177 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: D51 (= D54), Y52 (≠ L55), C67 (≠ A70), T68 (= T71), P69 (= P72), H73 (= H76), E90 (= E93), K91 (≠ I94), P92 (= P95), Q119 (≠ T122), V159 (≠ F153), F160 (≠ R154), Q166 (≠ A160)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
32% identity, 37% coverage: 25:141/315 of query aligns to 24:140/332 of 2glxA
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
32% identity, 37% coverage: 25:141/315 of query aligns to 25:141/333 of Q2I8V6
- S33 (≠ G33) mutation to D: No activity.
- ST 33:34 (≠ GG 33:34) binding
- R38 (≠ D38) binding
- TTNELH 71:76 (≠ TPTPVH 71:76) binding
- EK 93:94 (≠ EI 93:94) binding
- K94 (≠ I94) mutation to G: Less than 1% remaining activity.
- N120 (≠ G120) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
28% identity, 58% coverage: 64:247/315 of query aligns to 61:245/355 of 6o15A
Sites not aligning to the query:
7xreC Crystal structure of dgpa
25% identity, 83% coverage: 52:312/315 of query aligns to 59:355/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: T78 (= T71), P79 (= P72), N80 (≠ T73), H83 (= H76), E100 (= E93), K101 (≠ I94), P102 (= P95), F170 (≠ R154), Q176 (≠ A160), H187 (vs. gap), Y313 (≠ L277), F314 (≠ I278)
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
32% identity, 37% coverage: 25:141/315 of query aligns to 25:141/333 of 4koaA
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
22% identity, 71% coverage: 1:225/315 of query aligns to 5:236/342 of 3ceaA
- active site: K98 (≠ I94), H185 (= H178)
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G13 (= G10), R14 (≠ A11), L15 (≠ F12), L38 (≠ G34), Q42 (≠ D38), V74 (≠ A70), A75 (≠ T71), P76 (= P72), T77 (= T73), F79 (≠ V75), H80 (= H76), M83 (≠ Q79), E97 (= E93), K98 (≠ I94), M127 (≠ T122), F169 (≠ P164), H185 (= H178)
Sites not aligning to the query:
6z3cAAA Gfo/Idh/MocA family oxidoreductase (see paper)
26% identity, 57% coverage: 8:188/315 of query aligns to 18:196/379 of 6z3cAAA
- binding nicotinamide-adenine-dinucleotide: G20 (= G10), Y21 (≠ A11), F22 (= F12), L42 (≠ V32), D43 (≠ E35), P44 (= P36), A77 (= A70), T78 (= T71), P79 (= P72), N80 (≠ T73), H83 (= H76), E100 (= E93), K101 (≠ I94), V129 (≠ T122), W170 (≠ L161), K171 (≠ G162), H183 (= H174)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
31% identity, 44% coverage: 1:139/315 of query aligns to 10:147/332 of B3TMR8
- 17:23 (vs. 8:14, 14% identical) binding
- SR 42:43 (≠ GG 33:34) binding
- Y63 (≠ L55) binding
- L79 (≠ T71) binding
- H84 (= H76) binding
- K102 (≠ I94) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
Sites not aligning to the query:
- 170 binding
- 182 binding
- 186 Y→F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
Query Sequence
>AZOBR_RS26915 FitnessBrowser__azobra:AZOBR_RS26915
MRICVAGAAGAFGVKHLEAVAAIDGVEVVSVVGGEPDDIEGFAKARGIPHWTKDLAESLE
RADVEAVILATPTPVHATQAIQCLEAGKHVLVEIPMADSLADAERLVAAQRTSGLVAMAG
HTRRFNPSHQWIRNRVQAGELTIQQMDVQTYFFRRSNMNALGKPRTWTDHLLWHHACHTV
DLFQYQTGEVASQMHALQGPAHPQLGIAMDMSIGMKVPSGAICTLSLSFNNDGPLGTFFR
YICDNGTYIARYDDLYDGKDNKIDLSGLTVSTNGIELIDREFFAAIRDGREPNASVAQCL
PAMRTLDRLEKSLNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory