SitesBLAST
Comparing AZOBR_RS26920 FitnessBrowser__azobra:AZOBR_RS26920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
51% identity, 96% coverage: 5:440/454 of query aligns to 10:446/448 of Q51955
- D41 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D39) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G80) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D84) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G87) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R119) mutation to A: Abolishes 4-HBA transport.
- E144 (= E139) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R178) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D317) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ N322) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R380) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R392) mutation to A: Abolishes 4-HBA transport.
- H444 (≠ P438) mutation to A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
42% identity, 94% coverage: 5:432/454 of query aligns to 3:429/452 of Q5EXK5
- D82 (= D84) mutation to A: Loss of activity.
- V311 (≠ W314) mutation to W: Loss of activity.
- D314 (= D317) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
32% identity, 90% coverage: 24:432/454 of query aligns to 15:389/403 of P77589
- E27 (≠ D36) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D84) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ W314) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R318) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
30% identity, 81% coverage: 30:396/454 of query aligns to 48:390/444 of Q8NLB7
- D54 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D39) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R85) mutation to A: Loss of transport activity.
- W309 (= W314) mutation to V: Loss of transport activity.
- D312 (= D317) mutation to A: Loss of transport activity.
- R313 (= R318) mutation to A: Loss of transport activity.
- I317 (≠ N322) mutation I->H,Y: Loss of transport activity.
- R386 (= R392) mutation to A: Loss of transport activity.
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
26% identity, 85% coverage: 65:452/454 of query aligns to 144:527/550 of Q9NSA0
- G241 (= G160) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (≠ G229) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ A321) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ L388) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
26% identity, 79% coverage: 71:427/454 of query aligns to 158:507/554 of O15245
- L160 (≠ A73) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ A102) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A133) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ M153) mutation to F: Decreased TEA uptake.
- P283 (= P200) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (= R204) to G: in dbSNP:rs4646278
- P341 (≠ G255) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ Y256) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ F274) mutation to F: Decreased TEA uptake.
- Y376 (≠ G289) mutation to F: Decreased TEA uptake.
- G401 (≠ N320) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ F327) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (≠ I339) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (≠ I359) to I: in dbSNP:rs35956182
- V461 (≠ G379) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G383) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
- R488 (= R408) to M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
24% identity, 75% coverage: 71:412/454 of query aligns to 159:495/555 of Q9R0W2
- C451 (≠ A369) Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; mutation to M: Transport activity strongly reduced.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 49% coverage: 10:232/454 of query aligns to 153:386/742 of Q02563
- DMCLS 196:200 (≠ EWGIA 53:57) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 178:178, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
25% identity, 48% coverage: 13:232/454 of query aligns to 142:372/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
25% identity, 48% coverage: 13:232/454 of query aligns to 142:372/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q8MJI6 Solute carrier family 22 member 2; Organic cation transporter 2 from Oryctolagus cuniculus (Rabbit) (see paper)
26% identity, 85% coverage: 66:450/454 of query aligns to 153:526/554 of Q8MJI6
Sites not aligning to the query:
- 71 N→Q: Higher affinity for TEA. Loss of plasma membrane localization; when associated with Q-76. Loss of plasma membrane localization; when associated with Q-112. Loss of plasma membrane localization; when associated with Q-76 and Q-112.
- 96 N→Q: Higher affinity for TEA and lower Vmax.
- 112 N→Q: Higher affinity for TEA, lower Vmax and loss of plasma membrane localization.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 55% coverage: 84:334/454 of query aligns to 93:356/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
O15244 Solute carrier family 22 member 2; Organic cation transporter 2; hOCT2 from Homo sapiens (Human) (see 8 papers)
24% identity, 76% coverage: 66:411/454 of query aligns to 154:494/555 of O15244
- M165 (≠ L77) to I: lower Vmax for MPP(+) transport; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177507
- Y169 (≠ P81) mutation to F: No change in TEA uptake.
- T201 (≠ D113) to M: in dbSNP:rs145450955
- Y241 (≠ F157) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-362 and F-377.
- Y257 (≠ W170) mutation to F: No change in TEA uptake.
- S270 (≠ I186) to A: decreased Ki value for TBA inhibition of MPP(+); no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs316019
- Y279 (≠ L195) mutation to F: No change in TEA uptake.
- Y280 (≠ L196) mutation to F: No change in TEA uptake.
- P284 (= P200) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- PESPR 284:288 (≠ PESVR 200:204) Proline-rich sequence
- S286 (= S202) mutation to A: No change in TEA and metformin uptake. No change in tyrosine phosphorylation.
- P287 (≠ V203) mutation to A: Decreased TEA and metformin uptake. Decreased tyrosine phosphorylation.
- Y362 (≠ F274) mutation to F: Decreased TEA uptake and YES1-mediated tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-241. Strong decrease in TEA uptake; when associated with F-377. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-377.
- Y377 (≠ G289) mutation to F: Slight decrease in TEA uptake. No change in tyrosine phosphorylation. Strong decrease in TEA uptake; when associated with F-362. Strong decrease in TEA and metformin uptake and YES1-mediated tyrosine phosphorylation; when associated with F-241 and F-362.
- R400 (= R318) to C: lower Vmax and reduced Ki value for TBA inhibition of MPP(+); lower transport efficiency (Vmax/Km) and clearance of cyclo(his-pro); no change in transport efficiency (Vmax/Km) and clearance of salsolinol; dbSNP:rs8177516
- K432 (≠ V350) to Q: lower Km value for MPP(+) and reduced Ki value for TBA inhibition of MPP; no change in transport efficiency (Vmax/Km) and clearance of cyclo(his-pro) and salsolinol; dbSNP:rs8177517
- Y458 (= Y375) mutation to F: No change in TEA uptake.
Sites not aligning to the query:
- 54 P → S: in dbSNP:rs8177504
- 73 Y→F: No change in TEA uptake.
- 92 Y→F: No change in TEA uptake.
- 128 Y→F: No change in TEA uptake.
- 544 Y→F: No change in TEA uptake.
7zh6A Structure of human oct3 in complex with inhibitor corticosterone (see paper)
25% identity, 85% coverage: 65:450/454 of query aligns to 121:474/478 of 7zh6A
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
34% identity, 30% coverage: 71:204/454 of query aligns to 140:269/453 of 8sc2A
Sites not aligning to the query:
8sc3A Human oct1 bound to fenoterol in inward-open conformation (see paper)
35% identity, 25% coverage: 71:182/454 of query aligns to 140:250/445 of 8sc3A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
35% identity, 25% coverage: 71:182/454 of query aligns to 140:250/447 of 8sc6A
Sites not aligning to the query:
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
23% identity, 75% coverage: 66:405/454 of query aligns to 154:488/556 of Q63089
- C155 (≠ A67) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ I91) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L124) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G125) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L126) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G127) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (≠ A128) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ A129) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ M130) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ P131) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ N132) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ A133) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ V134) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T135) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (= L136) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ M137) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ S138) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E139) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ Y140) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ C141) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (= S202) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (≠ A208) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ P212) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- C322 (≠ V234) mutation to S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- S328 (≠ P240) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- C358 (≠ G270) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- C418 (≠ V336) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- C437 (≠ A355) mutation to S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- C451 (≠ A369) mutation to M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- C470 (≠ M387) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- C474 (≠ G391) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- D475 (≠ R392) mutation to E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; mutation to N: Decreased MPP(+) uptake.; mutation to R: Decreased MPP(+) uptake.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
25% identity, 35% coverage: 66:225/454 of query aligns to 154:308/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
21% identity, 66% coverage: 20:317/454 of query aligns to 12:301/430 of P0AA76
- Y29 (≠ G37) binding
- D31 (= D39) mutation to N: Loss of galactonate transport activity.
- R32 (≠ T40) binding
- Y64 (≠ L72) binding
- E118 (≠ L126) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
Query Sequence
>AZOBR_RS26920 FitnessBrowser__azobra:AZOBR_RS26920
MPTARSVDVQAFLNEHPFSRYQWLVFALCFFIVLLDGFDTAAIGYIAPSLTTEWGIARPA
LAPVLSAALFGLAFGALSAGPLADRFGRKAILIGSVLVIGTACLASAFSGNLDQLVMLRF
VTGLGLGAAMPNAVTLMSEYCPEGRRAMVTNAMFCGFPLGAAFGGFLAAWMIPLWGWRSV
LVLGGIAPLVLAAVLLVLLPESVRYMVAHNHPVERIRAVLRRISETAAGAAGFVMTEKAP
ATKARNGIAVVLSRGYLVGSVMLWVAYFMGLVIFYALINWMPILFKDAGLAPRDAALIAA
LFPLGGVGAVLSGWLMDRFNANRIIAFGFVLTYGAVYAIGQVAGNVGLLVVTVFAAGTIM
NTAQTSLPALAASFYPTHGRATGVAWMLGLGRFGGIGGSFLVAELARRQLDFTSIFAIVA
VPGLVAALALLVKQFVHPEDRSSGTGRTVEALGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory