SitesBLAST
Comparing AZOBR_RS27055 FitnessBrowser__azobra:AZOBR_RS27055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
39% identity, 96% coverage: 7:376/384 of query aligns to 6:367/393 of P20932
- PTG 79:81 (≠ PTA 80:82) binding
- G81 (≠ A82) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S109) binding
- Q129 (= Q130) binding
- T156 (= T158) binding
- K250 (= K257) binding
- DSGFR 303:307 (≠ DSGVR 312:316) binding
- GR 326:327 (= GR 335:336) binding
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
39% identity, 96% coverage: 7:376/384 of query aligns to 4:365/373 of 6bfgA
- active site: Y129 (= Y132), D156 (= D160), H272 (= H281)
- binding flavin mononucleotide: Y24 (= Y27), P77 (= P80), T78 (= T81), G79 (≠ A82), Q127 (= Q130), Y129 (= Y132), T154 (= T158), K248 (= K257), H272 (= H281), G273 (= G282), R275 (= R284), D301 (= D312), S302 (= S313), G303 (= G314), R305 (= R316), G324 (= G335), R325 (= R336)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
37% identity, 96% coverage: 7:376/384 of query aligns to 3:345/353 of 2a85A
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K228 (= K257), H252 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (= T81), A78 (= A82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K228 (= K257), H252 (= H281), G253 (= G282), R255 (= R284), D281 (= D312), S282 (= S313), G283 (= G314), R285 (= R316), G304 (= G335), R305 (= R336)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y132), N159 (≠ T164), G160 (≠ P165), R162 (= R167), H252 (= H281), R255 (= R284)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
37% identity, 96% coverage: 7:376/384 of query aligns to 3:345/353 of 2a7pA
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K228 (= K257), H252 (= H281)
- binding 3-(indol-3-yl) lactate: Y128 (= Y132), R162 (= R167), H252 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (= T81), A78 (= A82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K228 (= K257), H252 (= H281), G253 (= G282), R255 (= R284), D281 (= D312), S282 (= S313), G283 (= G314), R285 (= R316), G304 (= G335), R305 (= R336)
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
37% identity, 96% coverage: 7:376/384 of query aligns to 3:341/349 of 1huvA
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K224 (= K257), H248 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (= T81), G78 (≠ A82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K224 (= K257), H248 (= H281), G249 (= G282), R251 (= R284), D277 (= D312), S278 (= S313), G279 (= G314), R281 (= R316), G300 (= G335), R301 (= R336)
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
35% identity, 96% coverage: 8:376/384 of query aligns to 4:343/353 of 5zbmB
- active site: Y128 (= Y132), D156 (= D160), H248 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), Y24 (≠ I28), P76 (= P80), T77 (= T81), W107 (≠ Q111), Q126 (= Q130), Y128 (= Y132), T154 (= T158), K224 (= K257), H248 (= H281), G249 (= G282), R251 (= R284), D279 (= D312), G280 (≠ S313), R283 (= R316), G302 (= G335), R303 (= R336)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
34% identity, 96% coverage: 8:376/384 of query aligns to 5:349/369 of P05414
- Y24 (= Y27) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (= PTA 80:82) binding
- S106 (= S109) binding
- W108 (≠ Q111) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 130:132) binding
- T155 (= T158) binding
- K230 (= K257) binding
- S252 (= S279) binding
- DGGVR 285:289 (≠ DSGVR 312:316) binding
- GR 308:309 (= GR 335:336) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
35% identity, 96% coverage: 8:376/384 of query aligns to 5:340/350 of 1al7A
- active site: S106 (= S109), Y129 (= Y132), T155 (= T158), D157 (= D160), K221 (= K257), H245 (= H281)
- binding flavin mononucleotide: Y24 (= Y27), Y25 (≠ I28), P77 (= P80), T78 (= T81), A79 (= A82), S106 (= S109), Q127 (= Q130), T155 (= T158), K221 (= K257), H245 (= H281), R248 (= R284), D276 (= D312), G277 (≠ S313), R280 (= R316), G299 (= G335), R300 (= R336)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y27), W108 (≠ Q111), Y129 (= Y132), R164 (= R167), F172 (= F175), I198 (= I232), H245 (= H281), R248 (= R284)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
34% identity, 97% coverage: 9:382/384 of query aligns to 5:358/359 of 5qigA
- active site: Y129 (= Y132), D157 (= D160), H257 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), Y24 (≠ I28), A76 (≠ P80), T77 (= T81), A78 (= A82), S105 (= S109), Q127 (= Q130), Y129 (= Y132), T155 (= T158), K233 (= K257), H257 (= H281), G258 (= G282), R260 (= R284), D288 (= D312), G289 (≠ S313), G290 (= G314), R292 (= R316), G311 (= G335), R312 (= R336)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (= R247), G248 (= G272), F320 (≠ T344), K324 (≠ A348), D328 (≠ A352)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
34% identity, 97% coverage: 9:382/384 of query aligns to 5:358/359 of 5qifA
- active site: Y129 (= Y132), D157 (= D160), H257 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), Y24 (≠ I28), A76 (≠ P80), T77 (= T81), A78 (= A82), S105 (= S109), Q127 (= Q130), Y129 (= Y132), K233 (= K257), H257 (= H281), G258 (= G282), R260 (= R284), D288 (= D312), G289 (≠ S313), R292 (= R316), G311 (= G335), R312 (= R336)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R247), R224 (≠ D248), S227 (≠ K251)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
34% identity, 97% coverage: 9:382/384 of query aligns to 5:358/359 of 2rdwA
- active site: S105 (= S109), Y129 (= Y132), T155 (= T158), D157 (= D160), K233 (= K257), H257 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), Y24 (≠ I28), A76 (≠ P80), T77 (= T81), A78 (= A82), Q127 (= Q130), Y129 (= Y132), T155 (= T158), K233 (= K257), H257 (= H281), G258 (= G282), R260 (= R284), D288 (= D312), G289 (≠ S313), R292 (= R316), G311 (= G335), R312 (= R336)
- binding sulfate ion: Y23 (= Y27), W107 (≠ Q111), R164 (= R167), H257 (= H281), R260 (= R284)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
34% identity, 97% coverage: 9:382/384 of query aligns to 8:361/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
34% identity, 97% coverage: 9:382/384 of query aligns to 8:361/362 of 6gmbA
- active site: Y132 (= Y132), D160 (= D160), H260 (= H281)
- binding flavin mononucleotide: Y26 (= Y27), Y27 (≠ I28), A79 (≠ P80), T80 (= T81), A81 (= A82), S108 (= S109), Q130 (= Q130), Y132 (= Y132), K236 (= K257), H260 (= H281), G261 (= G282), R263 (= R284), D291 (= D312), G292 (≠ S313), G293 (= G314), R295 (= R316), G314 (= G335), R315 (= R336)
- binding glycolic acid: Y26 (= Y27), W110 (≠ Q111), Y132 (= Y132), R167 (= R167), H260 (= H281), R263 (= R284)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
34% identity, 97% coverage: 9:382/384 of query aligns to 6:359/360 of 2rduA
- active site: S106 (= S109), Y130 (= Y132), T156 (= T158), D158 (= D160), K234 (= K257), H258 (= H281)
- binding flavin mononucleotide: Y24 (= Y27), Y25 (≠ I28), A77 (≠ P80), T78 (= T81), A79 (= A82), S106 (= S109), Q128 (= Q130), Y130 (= Y132), T156 (= T158), K234 (= K257), H258 (= H281), G259 (= G282), R261 (= R284), D289 (= D312), G290 (≠ S313), G291 (= G314), R293 (= R316), G312 (= G335), R313 (= R336)
- binding glyoxylic acid: Y24 (= Y27), W108 (≠ Q111), Y130 (= Y132), R165 (= R167), H258 (= H281), R261 (= R284)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
34% identity, 98% coverage: 7:382/384 of query aligns to 3:352/353 of 5qieA
- active site: Y129 (= Y132), D157 (= D160), H251 (= H281)
- binding flavin mononucleotide: Y23 (= Y27), Y24 (≠ I28), A76 (≠ P80), T77 (= T81), A78 (= A82), S105 (= S109), Q127 (= Q130), Y129 (= Y132), K227 (= K257), H251 (= H281), G252 (= G282), R254 (= R284), D282 (= D312), G283 (≠ S313), R286 (= R316), G305 (= G335), R306 (= R336)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ L7), D322 (≠ A352)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
34% identity, 96% coverage: 8:376/384 of query aligns to 5:334/344 of 1al8A
- active site: S106 (= S109), Y129 (= Y132), T155 (= T158), D157 (= D160), K215 (= K257), H239 (= H281)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y27), W108 (≠ Q111), Y129 (= Y132), F166 (= F175), H239 (= H281), R242 (= R284)
- binding flavin mononucleotide: Y25 (≠ I28), P77 (= P80), T78 (= T81), A79 (= A82), S106 (= S109), Q127 (= Q130), Y129 (= Y132), T155 (= T158), K215 (= K257), H239 (= H281), R242 (= R284), D270 (= D312), G271 (≠ S313), R274 (= R316), G293 (= G335), R294 (= R336)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
36% identity, 98% coverage: 2:376/384 of query aligns to 3:358/365 of Q8Z0C8
- M82 (≠ T81) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ Q111) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ Y215) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
P0DUR7 FMN-dependent alpha-hydroxy acid dehydrogenase qulF; Quinolactacin A2 biosynthesis cluster protein F; EC 1.13.12.- from Penicillium citrinum (see paper)
35% identity, 97% coverage: 2:375/384 of query aligns to 25:383/402 of P0DUR7
- H289 (= H281) mutation to A: Blocks the formatin of 2-aminobenzoylacetamide.
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
35% identity, 96% coverage: 7:373/384 of query aligns to 2:342/355 of 5zzqA
- active site: Y126 (= Y132), D154 (= D160), H250 (= H281)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ T81), A77 (= A82), Q124 (= Q130), Y126 (= Y132), T152 (= T158), K226 (= K257), H250 (= H281), R253 (= R284), D281 (= D312), G283 (= G314), R285 (= R316), G304 (= G335), R305 (= R336)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ Q111), Y126 (= Y132), M158 (≠ T164), R161 (= R167), T200 (≠ Y215), F204 (= F219), H250 (= H281), R253 (= R284)
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
35% identity, 96% coverage: 7:373/384 of query aligns to 2:342/354 of 6a24A
- active site: Y126 (= Y132), D154 (= D160), H250 (= H281)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ T81), A77 (= A82), Q124 (= Q130), Y126 (= Y132), T152 (= T158), K226 (= K257), H250 (= H281), G251 (= G282), R253 (= R284), D281 (= D312), G282 (≠ S313), G283 (= G314), R285 (= R316), G304 (= G335), R305 (= R336)
- binding pyruvic acid: R161 (= R167), H250 (= H281), R253 (= R284)
Query Sequence
>AZOBR_RS27055 FitnessBrowser__azobra:AZOBR_RS27055
MAVTASLNIAEARQRARARLPRGLFEYIDRGAEDETGIATSKTALDSLVFKPRVLVDVSK
RDATTRLFGVDQPMPLVVAPTAVAGLVWYDGEVELAKAAAAVGIPFCVSTQSITSVERIA
GESGARLWFQLYVWRSRERTRELVRRAERAGAEALVLTVDTAVTPNREYNVRNGFGIPIK
PSVRAGLDCLAHPRWFAGVFAKYLRNGGVPTYAHYPDEFRTALGRVAVGDEIGLAQDVGW
GDVRSLRDAWKGKLILKGVLRADDAEKAAELGVDGIVVSNHGARNLDHAIHPVRCLTDIA
ERVGDRVTVLADSGVRRGSHVAGYLGLGAQGVLLGRAVLYGLATDGAAGAQAVLEMIRRE
LLTTMGFLGAPTVADIVGTVERPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory