Comparing AZOBR_RS27130 AZOBR_RS27130 polyamine ABC transporter substrate-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
37% identity, 89% coverage: 30:259/259 of query aligns to 4:254/256 of 5otcA
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
37% identity, 90% coverage: 26:259/259 of query aligns to 1:255/259 of 5ovzA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
37% identity, 89% coverage: 30:259/259 of query aligns to 4:254/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
37% identity, 89% coverage: 30:259/259 of query aligns to 4:254/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
37% identity, 89% coverage: 30:259/259 of query aligns to 4:254/254 of 4powA
5itoA Structure of the periplasmic binding protein m117n-noct from a. Tumefaciens in complex with octopine (see paper)
37% identity, 90% coverage: 26:259/259 of query aligns to 1:255/255 of 5itoA
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
40% identity, 89% coverage: 30:259/259 of query aligns to 6:256/257 of 5orgA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
38% identity, 99% coverage: 1:257/259 of query aligns to 1:257/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
38% identity, 88% coverage: 30:257/259 of query aligns to 3:232/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
38% identity, 88% coverage: 30:257/259 of query aligns to 6:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 88% coverage: 30:257/259 of query aligns to 6:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 88% coverage: 30:257/259 of query aligns to 6:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
38% identity, 88% coverage: 30:257/259 of query aligns to 6:235/238 of 1lafE
8hqrA Crystal structure of the arginine-/lysine-binding protein sar11_1210 from 'candidatus pelagibacter ubique' htcc1062 bound to arginine
38% identity, 92% coverage: 19:255/259 of query aligns to 1:263/267 of 8hqrA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
37% identity, 88% coverage: 30:257/259 of query aligns to 28:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
37% identity, 88% coverage: 30:257/259 of query aligns to 6:235/238 of 1hslA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
37% identity, 88% coverage: 30:257/259 of query aligns to 28:257/260 of P0AEU0
Sites not aligning to the query:
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
32% identity, 86% coverage: 30:252/259 of query aligns to 4:224/225 of 3tqlA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
34% identity, 86% coverage: 30:252/259 of query aligns to 6:224/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
33% identity, 86% coverage: 30:252/259 of query aligns to 6:222/225 of 4zv2A
>AZOBR_RS27130 AZOBR_RS27130 polyamine ABC transporter substrate-binding protein
MKRLALGLAMGLCALAAAVPTASRADGPPLRIATEGAYPPFNMTSPDGTLGGLEVELANA
LCERIKRRCTLVAQDWDGIIPGLLSRRYDAIMATMNITPERAKAIAFSAPYMVVPAYFVA
ATGGGIDGTEATLAGKSVGAQTSTTHYRYVEKHFGKTVSLKNYDTASNLLADLKSGRIDA
AITTGATASDWVKADASKSLQLVGKPLVDAEVFGPGVGVGLRKEDADLKAAFDAAIASVV
QDGTLARIAAKYVDFTVTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory