Comparing AZOBR_RS27160 FitnessBrowser__azobra:AZOBR_RS27160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
41% identity, 87% coverage: 41:325/327 of query aligns to 13:297/298 of 4ovrA
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
37% identity, 89% coverage: 38:327/327 of query aligns to 11:300/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
37% identity, 89% coverage: 38:327/327 of query aligns to 11:300/302 of 4mijA
Sites not aligning to the query:
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
37% identity, 89% coverage: 38:327/327 of query aligns to 41:330/330 of Q128M1
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
37% identity, 92% coverage: 27:327/327 of query aligns to 2:304/304 of 4x8rA
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
36% identity, 91% coverage: 28:324/327 of query aligns to 1:300/308 of 4n91A
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
42% identity, 87% coverage: 41:324/327 of query aligns to 9:298/300 of 4n8yA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
34% identity, 98% coverage: 6:327/327 of query aligns to 7:328/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
36% identity, 85% coverage: 48:326/327 of query aligns to 24:301/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
36% identity, 85% coverage: 48:326/327 of query aligns to 24:301/301 of 4n15A
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
36% identity, 88% coverage: 40:327/327 of query aligns to 12:299/306 of 4xfeA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
34% identity, 87% coverage: 41:324/327 of query aligns to 13:299/303 of 4p3lA
Sites not aligning to the query:
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
33% identity, 82% coverage: 39:306/327 of query aligns to 12:282/301 of 4x04A
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
36% identity, 86% coverage: 41:321/327 of query aligns to 12:295/300 of 4pf8A
Sites not aligning to the query:
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
36% identity, 88% coverage: 40:327/327 of query aligns to 12:302/302 of 4ovqA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
34% identity, 86% coverage: 26:306/327 of query aligns to 1:283/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
34% identity, 86% coverage: 26:306/327 of query aligns to 2:284/304 of 4pakA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
32% identity, 85% coverage: 28:306/327 of query aligns to 1:281/301 of 4pdhA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
31% identity, 86% coverage: 28:307/327 of query aligns to 1:282/303 of 4pddA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
30% identity, 91% coverage: 31:327/327 of query aligns to 8:308/310 of 7bbrA
>AZOBR_RS27160 FitnessBrowser__azobra:AZOBR_RS27160
MFALNRRHAALLAAAVLGLTLAGPAAAKTTLRLGHGLAKGHPVDVSLDEFAKLVRERSKG
ELDIKVFPAGQLGQQRELIEQMQNGALDLVHANASPLAAFEPGFGVYDMPFLFRDNDHFF
KVVEGAVGDEILASSRAKAFVGLAYYDNGTRSFYANKPLAKPEDLKGLKVRVQPGPIATR
MINLLGATATPLAWGEVYTALQSGVVDGAENNVTALTLARHGEVMKVYTRDEHTRVPDVV
LVATSTLDRLKPEQQELLRQAARDSAKAHNARWTAELEKAEGEAAKMGVKFVDADKAAYR
QMVQPMYDDLKATPALATLADRIQAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory