Comparing AZOBR_RS27540 FitnessBrowser__azobra:AZOBR_RS27540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
39% identity, 92% coverage: 6:179/189 of query aligns to 1:175/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
41% identity, 89% coverage: 10:177/189 of query aligns to 6:175/181 of 5dwnA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
39% identity, 91% coverage: 7:178/189 of query aligns to 2:171/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 90% coverage: 8:178/189 of query aligns to 1:169/171 of Q8ZPD3
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
39% identity, 83% coverage: 10:166/189 of query aligns to 4:159/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
39% identity, 83% coverage: 10:166/189 of query aligns to 3:158/173 of 5t7dA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
36% identity, 79% coverage: 21:169/189 of query aligns to 22:171/180 of 2jlmF
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
38% identity, 87% coverage: 5:169/189 of query aligns to 1:165/165 of 4jwpA
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
36% identity, 85% coverage: 10:169/189 of query aligns to 5:164/165 of 4mbuA
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
36% identity, 87% coverage: 6:169/189 of query aligns to 1:165/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
37% identity, 86% coverage: 7:169/189 of query aligns to 1:164/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
36% identity, 85% coverage: 9:169/189 of query aligns to 2:163/170 of 2j8rA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
32% identity, 87% coverage: 8:171/189 of query aligns to 2:164/179 of 5wphA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
32% identity, 87% coverage: 8:171/189 of query aligns to 2:164/176 of 6m7gA
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
34% identity, 59% coverage: 57:167/189 of query aligns to 52:162/165 of 2vi7C
>AZOBR_RS27540 FitnessBrowser__azobra:AZOBR_RS27540
VFDTSFSITIRPSTEADVAAMLEIYSYHIQHGLGPFDIEPLHPEELKRRRKAMLKRRLPH
LVAEIGGVVVGYAYAAPFRKRPAYRYTVEHSIYVHKDRQGLGIGRRLLPALIEACTAADC
RQMVAVVDSANTPSLRLHEAFGFVRAGVLRSVGFRFGRWTDSVFLQRSLGEADAELPDDV
RGGTVQAGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory