SitesBLAST
Comparing AZOBR_RS27880 FitnessBrowser__azobra:AZOBR_RS27880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6torB Human o-phosphoethanolamine phospho-lyase (see paper)
46% identity, 91% coverage: 42:438/438 of query aligns to 1:397/404 of 6torB
5g4jA Phospholyase a1rdf1 from arthrobacter in complex with phosphoethanolamine (see paper)
43% identity, 95% coverage: 22:438/438 of query aligns to 2:421/423 of 5g4jA
- active site: S14 (≠ Y34), Y130 (= Y150), D201 (= D218), D234 (= D251), Q237 (= Q254), K264 (= K281), T294 (= T311), K395 (= K412)
- binding {5-hydroxy-6-methyl-4-[(E)-{[2-(phosphonooxy)ethyl]imino}methyl]pyridin-3-yl}methyl dihydrogen phosphate: Y44 (= Y64), R73 (= R93), G103 (= G123), S104 (= S124), Y130 (= Y150), H131 (= H151), D234 (= D251), V236 (= V253), Q237 (= Q254), K264 (= K281), T294 (= T311), R397 (= R414)
5g4iA Plp-dependent phospholyase a1rdf1 from arthrobacter aurescens tc1 (see paper)
43% identity, 95% coverage: 22:438/438 of query aligns to 2:421/423 of 5g4iA
- active site: S14 (≠ Y34), Y130 (= Y150), D201 (= D218), D234 (= D251), Q237 (= Q254), K264 (= K281), T294 (= T311), K395 (= K412)
- binding pyridoxal-5'-phosphate: G103 (= G123), S104 (= S124), H131 (= H151), D234 (= D251), V236 (= V253), Q237 (= Q254), K264 (= K281)
- binding phosphate ion: Y44 (= Y64), R397 (= R414)
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
33% identity, 89% coverage: 44:435/438 of query aligns to 31:394/395 of Q5SHH5
- GT 113:114 (≠ GS 123:124) binding
- K254 (= K281) modified: N6-(pyridoxal phosphate)lysine
- T283 (= T311) binding
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
32% identity, 92% coverage: 34:435/438 of query aligns to 24:447/448 of 6io1B
- active site: Y151 (= Y150), D257 (= D251), K286 (= K281)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ T122), G118 (= G123), A119 (≠ S124), N122 (= N127), Y151 (= Y150), H152 (= H151), D257 (= D251), V259 (= V253), I260 (≠ Q254), K286 (= K281)
Sites not aligning to the query:
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 89% coverage: 44:435/438 of query aligns to 23:386/387 of 1wkhA
- active site: F132 (≠ Y150), E184 (≠ D218), D217 (= D251), Q220 (= Q254), K246 (= K281), T275 (= T311), R363 (≠ K412)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: Y46 (vs. gap), S104 (≠ T122), G105 (= G123), T106 (≠ S124), F132 (≠ Y150), S133 (≠ H151), E184 (≠ D218), E189 (≠ S223), D217 (= D251), I219 (≠ V253), K246 (= K281), R363 (≠ K412)
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 89% coverage: 44:435/438 of query aligns to 23:386/387 of 1wkgA
- active site: F132 (≠ Y150), E184 (≠ D218), D217 (= D251), Q220 (= Q254), K246 (= K281), T275 (= T311), R363 (≠ K412)
- binding n~2~-acetyl-n~5~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-l-ornithine: Y46 (vs. gap), G105 (= G123), T106 (≠ S124), F132 (≠ Y150), S133 (≠ H151), R135 (≠ V153), E184 (≠ D218), D217 (= D251), I219 (≠ V253), Q220 (= Q254), K246 (= K281), G273 (≠ F309), T274 (≠ N310), T275 (= T311)
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
33% identity, 89% coverage: 44:435/438 of query aligns to 23:386/387 of 1vefA
- active site: F132 (≠ Y150), D217 (= D251), K246 (= K281), T275 (= T311), R363 (≠ K412)
- binding pyridoxal-5'-phosphate: G105 (= G123), T106 (≠ S124), F132 (≠ Y150), S133 (≠ H151), E184 (≠ D218), D217 (= D251), I219 (≠ V253), K246 (= K281)
Sites not aligning to the query:
5m4bA Alpha-amino epsilon-caprolactam racemase d210a mutant in complex with plp and geminal diamine intermediate
32% identity, 98% coverage: 9:438/438 of query aligns to 3:425/439 of 5m4bA
- active site: Q21 (≠ E27), Y140 (= Y150), E208 (≠ D218), D241 (= D251), K244 (≠ Q254), K270 (= K281), T298 (= T311), E399 (≠ K412)
- binding [6-methyl-5-oxidanyl-4-[(~{E})-[(3~{R})-2-oxidanylideneazepan-3-yl]iminomethyl]pyridin-3-yl]methyl dihydrogen phosphate: W53 (vs. gap), S112 (≠ T122), G113 (= G123), S114 (= S124), Y140 (= Y150), H141 (= H151), E208 (≠ D218), D241 (= D251), V243 (= V253), K244 (≠ Q254), K270 (= K281)
1zobA Crystal structure of dialkylglycine decarboxylases bound with calcium ion
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1zobA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding calcium ion: L76 (≠ T90), S78 (≠ T92), V303 (≠ G313), S304 (≠ G314), D305 (≠ N315)
- binding pyridoxal-5'-phosphate: T108 (= T122), A110 (≠ S124), N113 (= N127), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281)
Sites not aligning to the query:
1zc9A The crystal structure of dialkylglycine decarboxylase complex with pyridoxamine 5-phosphate (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1zc9A
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281)
Sites not aligning to the query:
1m0qA Structure of dialkylglycine decarboxylase complexed with s-1- aminoethanephosphonate (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1m0qA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: Q50 (≠ V67), T108 (= T122), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), S213 (= S223), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1m0pA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- phenylethanephosphonate (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1m0pA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-phenylethylphosphonic acid: Q50 (≠ V67), T108 (= T122), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), S213 (= S223), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1m0oA Structure of dialkylglycine decarboxylase complexed with 1-amino-1- methylpropanephosphonate (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1m0oA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding (1r)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]-1-methylpropylphosphonic acid: Q50 (≠ V67), G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1m0nA Structure of dialkylglycine decarboxylase complexed with 1- aminocyclopentanephosphonate (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1m0nA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding 1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]cyclopentylphosphonic acid: Q50 (≠ V67), M51 (≠ A68), A110 (≠ S124), N113 (= N127), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), S213 (= S223), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1dgdA An alkali metal ion size-dependent switch in the active site structure of dialkylglycine decarboxylase (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1dgdA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding pyridoxal-5'-phosphate: T108 (= T122), G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281)
Sites not aligning to the query:
1d7vA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with nma (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1d7vA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding potassium ion: H75 (vs. gap), L76 (≠ T90), F77 (≠ H91), S78 (≠ T92), T301 (= T311), H302 (≠ F312), V303 (≠ G313), S304 (≠ G314), D305 (≠ N315)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-2-methylalanine: A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), S213 (= S223), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1d7uA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with lcs (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1d7uA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding potassium ion: H75 (vs. gap), L76 (≠ T90), F77 (≠ H91), S78 (≠ T92), T301 (= T311), H302 (≠ F312), V303 (≠ G313), S304 (≠ G314), D305 (≠ N315)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
Sites not aligning to the query:
1d7sA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with dcs (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1d7sA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Q50 (≠ V67), G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
- binding potassium ion: H75 (vs. gap), L76 (≠ T90), F77 (≠ H91), S78 (≠ T92), T301 (= T311), H302 (≠ F312), V303 (≠ G313), S304 (≠ G314), D305 (≠ N315)
Sites not aligning to the query:
1d7rA Crystal structure of the complex of 2,2-dialkylglycine decarboxylase with 5pa (see paper)
32% identity, 90% coverage: 40:435/438 of query aligns to 23:427/431 of 1d7rA
- active site: W136 (≠ Y150), E208 (≠ D218), D241 (= D251), Q244 (= Q254), K270 (= K281), T301 (= T311), R404 (≠ K412)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: G109 (= G123), A110 (≠ S124), W136 (≠ Y150), H137 (= H151), E208 (≠ D218), S213 (= S223), D241 (= D251), A243 (≠ V253), Q244 (= Q254), K270 (= K281), R404 (≠ K412)
- binding potassium ion: H75 (vs. gap), L76 (≠ T90), F77 (≠ H91), S78 (≠ T92), T301 (= T311), H302 (≠ F312), V303 (≠ G313), S304 (≠ G314), D305 (≠ N315)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS27880 FitnessBrowser__azobra:AZOBR_RS27880
MTMINAYAPDSAGTLPERERALIARRERLLGPAYRLFYADPIHVVRGEGSSLYDAEGNRY
LDAYNNVASVGHSRPEVVEAMARQAAVLNTHTRYLTDGILDFAEAFLAEFPAELSHLMLT
CTGSEANDLALRVARVHTGGTGVVIAHNAYHGVTSALAEMSPSLGAAVKLGDHVRVVPAP
DGYRMPEAEVGAAFARSVEEAIADLREKGITPAALLVDTIFSSSGVFTDPAGFLAPAVEV
MRKAGGVFIADEVQPGFGRLGTHMWGFARHGLVPDIVTVGKPMGNGHPVAGAVFRPEVIE
AFGKSQRYFNTFGGNPVSCAVALAVLRVIKEDRLQENALTVGTEMIDGLRALAAKHELIG
DVRGSGLFIGVEMVRDRKLKTPASEETARVVNGMRQRRVLISATGQEGHILKIRPPLVFS
SEDAKLFLATLDEVLTAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory