SitesBLAST – Find functional sites

 

SitesBLAST

Comparing AZOBR_RS27895 AZOBR_RS27895 glutathione S-transferase to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
35% identity, 95% coverage: 2:194/204 of query aligns to 4:199/201 of 3m3mA

query
sites
3m3mA
K
 
K
L
 
V
Y
 
Y
H
 
G
H
 
D
P
 
Y
L
 
R
S
|
S
G
 
G
H
x
N
A
 
C
H
 
Y
R
 
K
A
 
I
R
 
K
L
 
L
F
 
M
V
 
L
S
 
N
L
 
L
L
 
L
G
 
G
L
 
L
P
 
P
H
 
Y
E
 
E
L
 
W
V
 
Q
E
 
A
V
 
V
D
 
D
L
x
I
K
 
L
A
 
G
G
 
G
A
 
D
H
x
T
K
 
Q
T
 
T
P
 
E
E
 
A
F
 
F
L
 
L
A
 
A
L
 
K
N
 
N
P
 
P
F
 
N
G
|
G
Q
x
K
V
x
I
P
 
P
V
 
V
L
 
L
D
 
E
-
 
L
D
 
E
D
 
D
G
 
G
V
 
T
V
 
C
V
 
L
S
 
W
D
x
E
S
|
S
N
 
N
A
 
A
I
 
I
L
 
L
V
 
N
Y
 
F
L
 
L
A
 
A
K
 
D
K
 
G
A
 
-
G
 
-
R
 
-
S
 
S
D
 
Q
W
 
F
L
 
L
P
 
P
E
 
S
D
 
E
A
 
P
R
 
R
N
 
L
A
 
R
A
 
T
A
 
Q
V
 
V
Q
 
L
R
 
Q
W
 
W
L
 
Q
S
 
F
V
 
F
A
 
E
A
x
Q
G
 
Y
E
 
S
V
 
H
A
 
E
Y
 
P
G
 
Y
P
 
I
A
 
A
A
 
V
A
 
A
R
 
R
L
 
F
V
 
I
T
 
Q
V
 
L
F
 
Y
G
 
E
A
 
G
G
 
-
F
 
-
N
 
L
P
 
P
D
 
E
E
 
E
-
 
R
-
 
R
-
 
E
-
 
E
-
 
Y
-
 
L
-
 
K
V
 
L
I
 
H
G
 
K
R
 
R
A
 
G
H
 
Y
T
 
K
L
 
A
L
 
L
K
 
D
R
 
V
L
 
M
D
 
E
S
 
K
H
 
Q
L
 
L
S
 
S
G
 
R
R
 
T
D
 
P
W
 
Y
L
 
L
V
 
V
G
 
G
L
 
E
Q
 
H
P
 
Y
T
 
S
I
 
I
A
 
A
D
 
D
V
 
I
A
 
A
I
 
L
Y
 
Y
S
 
A
Y
 
Y
V
 
T
A
 
H
R
 
V
A
 
A
P
 
D
E
 
E
G
 
G
N
 
G
V
 
F
D
 
D
L
 
L
S
 
S
G
 
R
Y
 
Y
P
 
P
A
 
G
V
 
I
N
 
Q
A
 
A
F
 
W
L
 
M
R
 
Q
R
 
R
V
 
V
E
 
Q
G
 
S
L
 
H
P
 
P
G
 
R
F
 
H
V
 
V
P
 
P
F
 
M

4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
36% identity, 94% coverage: 1:191/204 of query aligns to 2:195/206 of 4hz2B

query
sites
4hz2B
M
 
M
K
 
R
L
 
I
Y
 
Y
H
 
G
H
x
M
P
 
N
L
 
G
S
|
S
G
 
G
H
x
N
A
 
C
H
 
W
R
 
K
A
 
A
R
 
A
L
 
Q
F
 
I
V
 
L
S
 
S
L
 
L
L
 
T
G
 
G
L
 
H
P
 
D
H
 
F
E
 
E
L
 
W
V
 
V
E
 
E
V
 
T
D
 
S
L
x
S
K
 
G
A
 
A
G
 
A
A
 
G
H
x
T
K
 
R
T
 
S
P
 
A
E
 
D
F
 
F
L
 
L
A
 
A
L
 
L
N
 
N
P
 
A
F
 
I
G
|
G
Q
x
K
V
|
V
P
 
P
V
 
V
L
 
V
D
 
V
-
 
L
D
 
D
D
 
D
G
 
G
V
 
T
V
 
A
V
 
L
S
 
R
D
x
E
S
|
S
N
 
N
A
 
A
I
 
I
L
 
L
V
 
L
Y
 
H
L
 
F
A
 
A
K
 
E
K
 
G
A
 
-
G
 
-
R
 
-
S
 
T
D
 
P
W
 
W
L
 
L
P
 
P
E
 
P
D
 
P
A
 
G
R
 
L
N
 
A
A
 
R
A
 
T
A
 
R
V
 
V
Q
 
H
R
 
E
W
 
W
L
 
L
S
 
F
V
 
F
A
 
E
A
 
-
G
 
-
E
x
Q
V
 
Y
A
 
S
Y
 
H
G
 
E
P
 
P
-
 
Y
-
 
I
A
 
A
A
 
V
A
 
A
R
 
R
L
 
Y
V
 
L
T
 
K
V
 
S
F
 
W
G
 
L
A
 
R
G
 
Q
F
 
A
N
 
H
P
 
L
D
 
H
E
 
E
-
 
A
-
 
R
-
 
L
-
 
A
-
 
D
V
 
C
I
 
A
G
 
T
R
 
R
A
 
G
H
 
A
T
 
A
L
 
A
L
 
L
K
 
D
R
 
V
L
 
M
D
 
E
S
 
Q
H
 
H
L
 
L
S
 
A
G
 
G
R
 
E
D
 
P
W
 
W
L
 
L
V
 
V
G
 
G
L
 
E
Q
 
G
P
 
P
T
 
T
I
 
I
A
 
A
D
 
D
V
 
L
A
 
A
I
 
L
Y
 
F
S
 
A
Y
 
Y
V
 
T
A
 
H
R
 
R
A
 
A
P
 
E
E
 
E
G
 
A
N
 
D
V
 
F
D
 
D
L
 
L
S
 
A
G
 
Q
Y
 
W
P
 
P
A
 
A
V
 
V
N
 
L
A
 
A
F
 
W
L
 
V
R
 
D
R
 
R
V
 
V
E
 
A
G
 
A
L
 
L
P
 
P
G
 
G
F
 
I

4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
34% identity, 86% coverage: 16:191/204 of query aligns to 19:198/223 of 4pngB

query
sites
4pngB
R
 
K
L
 
L
F
 
T
V
 
L
S
 
A
L
 
A
L
 
L
G
 
E
L
 
V
P
 
P
H
 
Y
E
 
E
L
 
F
V
 
V
E
 
E
V
 
V
D
 
N
L
x
T
K
 
R
A
 
A
G
 
K
A
 
E
H
x
N
K
x
F
T
 
S
P
 
E
E
 
E
F
 
F
L
 
L
A
 
K
L
 
K
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
|
V
P
|
P
V
 
T
L
 
L
D
 
E
D
 
D
D
 
D
G
 
G
V
 
H
V
 
Y
V
 
I
S
 
W
D
|
D
S
|
S
N
x
H
A
 
A
I
 
I
L
 
I
V
 
A
Y
 
Y
L
 
L
A
 
V
K
 
S
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
T
D
 
D
W
 
S
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
L
R
 
L
N
 
Q
A
 
R
A
 
A
A
 
V
V
 
V
Q
 
D
R
 
Q
W
 
R
L
 
L
S
 
H
V
 
F
A
 
E
A
 
S
G
 
G
E
 
-
V
 
V
A
 
I
Y
x
F
G
 
A
P
 
N
A
 
A
A
 
L
A
x
R
R
 
S
L
 
I
V
 
T
T
 
K
V
 
P
F
 
L
G
 
F
A
 
A
G
 
G
F
 
K
N
 
Q
-
 
T
-
 
M
-
 
I
P
 
P
D
 
K
E
 
E
V
 
R
I
 
Y
G
 
D
R
 
A
A
 
I
H
 
I
T
 
E
L
 
V
L
 
Y
K
 
D
R
 
F
L
 
L
D
 
E
S
 
K
H
 
F
L
 
L
S
 
A
G
 
G
R
 
N
D
 
D
W
 
Y
L
 
V
V
 
A
G
 
G
L
 
N
Q
 
Q
P
 
L
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
S
I
 
I
Y
 
I
S
 
S
Y
 
T
V
 
V
A
 
S
R
 
S
A
 
L
P
 
E
E
 
V
G
 
F
-
 
V
N
 
K
V
 
V
D
 
D
L
 
T
S
 
T
G
 
K
Y
 
Y
P
 
P
A
 
R
V
 
I
N
 
A
A
 
A
F
 
W
L
 
F
R
 
K
R
 
R
V
 
L
E
 
Q
G
 
K
L
 
L
P
 
P
G
 
Y
F
 
Y

Sites not aligning to the query:

3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
32% identity, 94% coverage: 1:191/204 of query aligns to 3:195/214 of 3wywB

query
sites
3wywB
M
 
I
K
 
D
L
 
L
Y
 
Y
H
 
Y
H
 
V
P
 
P
L
 
G
S
|
S
G
 
A
H
x
P
A
 
C
H
 
R
R
 
N
A
 
V
R
 
L
L
 
L
F
 
A
V
 
A
S
 
K
L
 
A
L
 
V
G
 
G
L
 
V
P
 
D
H
 
L
E
 
N
L
 
L
V
 
K
E
 
L
V
 
T
D
 
D
L
|
L
K
 
K
A
 
S
G
 
G
A
 
Q
H
|
H
K
 
L
T
 
T
P
 
P
E
 
E
F
 
F
L
 
I
A
 
K
L
 
L
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
N
V
|
V
P
|
P
V
 
T
L
 
L
D
 
D
D
 
D
D
 
N
G
 
G
V
 
F
V
 
V
V
 
L
S
 
N
D
x
E
S
|
S
N
x
R
A
 
A
I
 
I
L
 
M
V
 
T
Y
 
Y
L
 
L
A
 
A
K
 
D
K
 
Q
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
S
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
K
N
 
K
A
 
R
A
 
A
A
 
K
V
 
V
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
 
M
G
 
G
E
 
T
V
 
L
A
 
Y
Y
 
Q
G
 
S
P
 
F
A
 
G
A
 
D
A
 
A
R
 
Y
L
 
Y
V
 
P
T
 
H
V
 
M
F
 
F
G
 
G
A
 
G
G
 
A
F
 
P
N
 
L
P
 
D
D
 
E
E
 
D
V
 
K
I
 
K
G
 
K
R
 
K
A
 
L
H
 
G
T
 
D
L
 
A
L
 
L
K
 
V
R
 
F
L
 
L
D
 
D
S
 
G
H
 
F
L
 
L
S
 
E
G
 
K
R
 
S
D
 
A
W
 
F
L
 
V
V
 
A
G
 
G
L
 
E
Q
 
D
P
 
L
T
 
T
I
 
L
A
 
A
D
 
D
V
 
L
A
 
A
I
 
I
Y
 
V
S
 
A
Y
 
S
V
 
I
A
 
S
R
 
T
A
 
I
P
 
E
E
 
A
G
 
V
N
 
E
V
 
Y
D
 
D
L
 
L
S
 
S
G
 
P
Y
 
Y
P
 
K
A
 
N
V
 
I
N
 
N
A
 
S
F
 
W
L
 
Y
R
 
S
R
 
K
V
 
V
E
 
K
-
 
A
G
 
A
L
 
A
P
 
P
G
 
G
F
 
Y

5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
34% identity, 96% coverage: 1:196/204 of query aligns to 2:209/213 of 5f06A

query
sites
5f06A
M
 
L
K
 
K
L
 
L
Y
 
Y
H
 
G
H
 
A
P
 
P
L
x
M
S
|
S
G
x
T
H
x
C
A
 
T
H
 
S
R
 
R
A
 
V
R
 
L
L
 
T
F
 
C
V
 
L
S
 
H
L
 
E
L
 
K
G
 
N
L
 
L
P
 
D
H
 
F
E
 
E
L
 
L
V
 
V
E
 
P
V
 
V
D
 
D
L
 
L
K
 
F
A
 
A
G
 
G
A
 
E
H
|
H
K
 
K
T
 
Q
P
 
P
E
 
P
F
 
F
L
 
L
A
 
A
L
 
K
N
 
N
P
 
P
F
 
F
G
 
G
Q
|
Q
V
x
I
P
 
P
V
 
A
L
 
L
D
 
E
D
 
E
D
 
D
G
 
D
V
 
L
V
 
T
V
 
L
S
 
F
D
x
E
S
|
S
N
 
R
A
 
A
I
 
I
L
 
T
V
 
S
Y
 
Y
L
 
I
A
 
A
K
 
E
K
 
K
-
 
F
-
 
K
-
 
G
A
 
T
G
 
G
R
 
Y
S
 
D
D
 
L
W
 
I
L
 
R
P
 
H
E
 
E
D
 
N
A
 
L
R
 
K
N
 
E
A
 
A
A
 
A
A
 
S
V
 
V
Q
 
K
R
 
V
W
 
W
L
 
T
S
 
E
V
 
V
A
 
E
A
 
S
G
x
H
E
x
R
V
 
-
A
 
-
Y
 
Y
G
 
N
P
 
P
A
 
A
A
 
I
A
 
A
R
 
P
L
 
I
V
 
V
T
 
F
V
 
Q
F
 
F
G
 
M
A
 
V
-
 
A
-
 
P
-
 
L
-
 
R
G
 
G
F
 
N
N
 
S
P
 
P
D
 
D
E
 
Q
V
 
T
I
 
I
-
 
I
-
 
D
G
 
D
R
 
N
A
 
V
H
 
E
T
 
K
L
 
L
L
 
G
K
 
K
R
 
V
L
 
L
D
 
D
-
 
I
-
 
Y
-
 
E
S
 
A
H
 
K
L
 
L
S
 
S
G
 
S
R
 
T
D
 
K
W
 
Y
L
 
L
V
 
A
G
 
G
L
 
D
Q
 
F
P
 
Y
T
 
S
I
 
L
A
 
A
D
 
D
-
 
L
-
 
H
-
 
H
V
 
L
A
 
P
I
 
Y
Y
 
T
S
 
Y
Y
 
Y
V
 
L
A
 
M
R
 
K
A
 
T
P
 
P
E
 
A
G
 
A
N
 
S
V
 
V
D
 
-
L
 
V
S
 
N
G
 
E
Y
 
R
P
 
P
A
 
H
V
 
V
N
 
K
A
 
A
F
 
W
L
 
W
R
 
E
R
 
D
V
 
I
E
 
S
G
 
S
L
 
R
P
 
P
G
 
A
F
 
F
V
 
K
P
 
K
F
 
V
A
 
A
Q
 
E

7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
33% identity, 94% coverage: 1:191/204 of query aligns to 2:177/183 of 7pkaA

query
sites
7pkaA
M
 
I
K
 
K
L
 
L
Y
 
Y
H
 
G
H
 
A
P
 
P
L
 
Q
S
|
S
G
 
-
H
x
R
A
 
A
H
 
S
R
 
I
A
 
I
R
 
Q
L
 
W
F
 
Y
V
 
L
S
 
E
L
 
E
L
 
L
G
 
S
L
 
L
P
 
P
H
 
Y
E
 
E
L
 
F
V
 
V
E
 
N
V
 
V
D
 
N
L
|
L
K
 
K
A
 
E
G
 
G
A
 
E
H
|
H
K
 
R
T
 
Q
P
 
A
E
 
P
F
 
Y
L
 
L
A
 
A
L
 
I
N
 
N
P
 
P
F
 
F
G
|
G
Q
x
K
V
|
V
P
 
P
V
 
A
L
 
I
D
 
A
D
 
D
D
 
G
G
 
N
V
 
F
V
 
H
V
 
L
S
 
W
D
x
E
S
|
S
N
 
G
A
 
A
I
 
I
L
 
L
V
 
L
Y
 
Y
L
 
L
A
 
A
K
 
E
K
 
K
A
 
A
G
 
S
R
 
T
S
 
-
D
 
-
W
 
-
L
 
I
P
 
P
E
 
A
D
 
D
A
 
A
R
 
Q
N
 
A
A
 
R
A
 
A
A
 
L
V
 
V
Q
 
N
R
 
Q
W
 
W
L
 
I
S
 
L
V
 
F
A
 
A
A
 
N
G
x
S
E
x
T
V
 
L
A
 
A
Y
 
N
G
 
G
P
 
-
A
 
-
A
 
-
A
 
-
R
 
-
L
 
-
V
 
-
T
 
-
V
 
L
F
 
F
G
 
I
A
 
E
G
 
A
F
 
V
N
 
R
P
 
E
D
 
K
E
 
E
V
 
M
I
 
-
G
 
-
R
 
-
A
 
-
H
 
P
T
x
R
L
 
L
L
 
L
K
 
Q
R
 
S
L
 
L
D
 
E
S
 
K
H
 
I
L
 
L
S
 
G
G
 
R
R
 
S
D
 
P
W
 
F
L
 
I
V
 
L
G
 
G
L
 
E
Q
 
K
P
 
F
T
 
S
I
 
V
A
 
V
D
 
D
V
 
V
A
 
A
I
 
V
Y
 
G
S
 
S
Y
 
I
V
 
L
A
 
A
R
 
Y
A
 
V
P
 
P
E
 
I
G
 
M
-
 
L
N
 
K
V
 
L
D
 
N
L
 
F
S
 
D
G
 
D
Y
 
Y
P
 
P
A
 
A
V
 
V
N
 
A
A
 
A
F
 
Y
L
 
V
R
 
Q
R
 
G
V
 
L
E
 
V
G
 
Q
L
 
R
P
 
P
G
 
A
F
 
F

4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
35% identity, 86% coverage: 16:191/204 of query aligns to 18:197/221 of 4pnfB

query
sites
4pnfB
R
 
K
L
 
L
F
 
T
V
 
L
S
 
A
L
 
A
L
 
L
G
 
N
L
 
L
P
 
T
H
 
Y
E
 
E
L
 
Y
V
 
V
E
 
N
V
 
V
D
 
D
L
 
I
K
 
V
A
 
A
G
 
R
A
 
A
H
x
Q
K
 
L
T
 
S
P
 
P
E
 
E
F
 
Y
L
 
L
A
 
E
L
 
K
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
|
V
P
 
P
V
 
T
L
 
L
D
 
E
D
 
D
D
 
D
G
 
G
V
 
H
V
 
Y
V
 
I
S
 
W
D
|
D
S
|
S
N
x
H
A
 
A
I
 
I
L
 
I
V
 
A
Y
 
Y
L
 
L
A
 
V
K
 
S
K
 
K
A
 
Y
G
 
A
R
 
D
S
 
S
D
 
D
W
 
A
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
L
N
 
K
A
 
R
A
 
A
A
 
V
V
 
V
Q
 
D
R
 
Q
W
 
R
L
 
L
S
 
H
V
 
F
A
 
E
A
 
S
G
 
G
E
 
V
V
 
V
-
x
F
A
 
A
Y
 
N
G
 
G
P
 
I
A
x
R
A
 
S
A
 
I
R
 
S
L
 
K
V
 
S
T
 
V
V
 
L
F
 
F
-
 
Q
G
 
G
A
 
Q
G
 
T
F
 
K
N
 
V
P
 
P
D
 
K
E
 
E
V
 
R
I
 
Y
G
 
D
R
 
A
A
 
I
H
 
I
T
 
E
L
 
I
L
 
Y
K
 
D
R
 
F
L
 
V
D
 
E
S
 
T
H
 
F
L
 
L
S
 
K
G
 
G
R
 
Q
D
 
D
W
 
Y
L
 
I
V
 
A
G
 
G
L
 
N
Q
 
Q
P
 
L
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
S
I
 
L
Y
 
V
S
 
S
Y
 
S
V
 
V
A
 
A
R
 
-
A
 
S
P
 
L
E
 
E
G
 
A
N
 
F
V
 
V
-
 
A
-
 
L
D
 
D
L
 
T
S
 
T
G
 
K
Y
 
Y
P
 
P
A
 
R
V
 
I
N
 
G
A
 
A
F
 
W
L
 
I
R
 
K
R
 
K
V
 
L
E
 
E
G
 
Q
L
 
L
P
 
P
G
 
Y
F
 
Y

Sites not aligning to the query:

3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 8:198/222 of 3zmkB

query
sites
3zmkB
L
 
L
Y
 
Y
H
 
T
H
 
L
P
 
H
L
 
L
S
|
S
G
 
P
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
E
L
 
L
F
 
T
V
 
A
S
 
K
L
 
A
L
 
L
G
 
G
L
 
L
P
 
E
H
 
L
E
 
E
L
 
Q
V
 
K
E
 
N
V
 
I
D
 
N
L
|
L
K
 
L
A
 
A
G
 
G
A
 
D
H
 
H
K
 
L
T
 
T
P
 
P
E
 
E
F
 
F
L
 
M
A
 
K
L
 
L
N
 
N
P
 
P
F
 
Q
G
 
H
Q
x
T
V
x
I
P
 
P
V
 
V
L
 
L
D
 
D
D
 
D
D
 
D
G
 
G
V
 
T
V
 
I
V
 
I
S
 
T
D
x
E
S
|
S
N
x
H
A
 
A
I
 
I
L
 
M
V
 
I
Y
 
Y
L
 
L
A
 
V
K
 
T
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
T
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
V
N
 
Q
A
 
Q
A
 
A
A
 
R
V
 
V
Q
 
N
R
 
A
W
 
A
L
 
L
S
 
H
V
 
F
A
 
E
A
 
S
G
 
G
E
 
V
V
 
L
-
x
F
A
 
A
Y
 
R
G
 
M
P
x
R
A
 
F
A
 
I
A
 
F
R
 
E
L
 
R
V
 
I
T
 
F
V
 
F
F
 
Y
G
 
G
A
 
K
G
 
S
F
 
D
N
 
I
P
 
P
D
 
E
E
 
D
V
 
R
I
 
V
G
 
E
R
 
Y
A
 
V
H
 
Q
T
 
K
L
 
S
L
 
Y
K
 
R
R
 
L
L
 
L
D
 
E
S
 
D
H
 
T
L
 
L
S
 
K
G
 
D
R
 
-
D
 
D
W
 
F
L
 
V
V
 
A
G
 
G
L
 
S
Q
 
K
P
 
M
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
S
I
 
C
Y
 
I
S
 
S
Y
 
T
V
 
I
A
 
S
R
 
-
A
 
S
P
 
I
E
 
M
G
 
G
N
 
V
V
 
V
D
 
P
L
 
L
-
 
E
-
 
Q
S
 
S
G
 
E
Y
 
H
P
 
P
A
 
R
V
 
I
N
 
Y
A
 
E
F
 
W
L
 
I
R
 
D
R
 
R
V
 
L
E
 
K
G
 
Q
L
 
L
P
 
P
G
 
Y
F
 
Y

4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
29% identity, 93% coverage: 1:189/204 of query aligns to 1:196/203 of 4l8eA

query
sites
4l8eA
M
 
I
K
 
D
L
 
L
Y
 
Y
H
 
Y
H
 
A
P
|
P
L
 
-
S
x
T
G
x
P
H
x
N
A
 
G
H
x
Y
R
 
K
A
 
I
R
 
T
L
 
L
F
 
F
V
 
L
S
 
E
L
 
E
L
 
V
G
 
G
L
 
L
P
 
P
H
 
Y
E
 
T
L
 
I
V
 
H
E
 
P
V
 
I
D
 
D
L
x
I
K
 
S
A
 
A
G
 
G
A
 
D
H
x
Q
K
 
F
T
 
K
P
 
P
E
 
E
F
 
F
L
 
L
A
 
A
L
 
I
N
 
A
P
 
P
F
 
N
G
x
N
Q
x
K
V
x
I
P
 
P
V
 
A
L
 
I
D
 
V
D
 
D
-
 
H
-
 
Q
-
 
P
-
 
D
-
 
G
-
 
G
-
 
G
D
 
E
G
 
A
V
 
I
V
 
S
V
 
I
S
 
F
D
x
E
S
|
S
N
 
G
A
 
A
I
 
I
L
 
L
V
 
L
Y
 
Y
L
 
L
A
 
A
K
 
N
K
 
K
A
 
T
G
 
G
R
 
R
S
 
-
D
 
-
W
 
F
L
 
L
P
 
S
E
 
K
D
 
D
A
 
T
R
 
R
N
 
E
A
 
R
A
 
T
A
 
E
V
 
Q
Q
 
L
R
 
Q
W
 
W
L
 
L
S
 
F
V
 
W
A
 
Q
A
 
V
G
 
A
E
 
-
V
 
-
A
 
G
Y
 
F
G
|
G
P
|
P
A
 
M
A
 
L
A
x
G
R
 
Q
L
 
-
V
 
-
T
 
-
V
 
-
F
 
-
G
 
N
A
x
H
G
 
H
F
 
F
N
 
N
-
 
R
-
 
Y
-
 
A
P
 
P
D
 
E
E
 
V
V
 
V
-
 
P
-
 
Y
-
 
A
I
 
I
G
 
K
R
 
R
-
 
Y
-
 
T
-
 
E
-
 
E
A
 
S
H
 
Q
T
 
R
L
 
L
L
 
Y
K
 
K
R
 
V
L
 
L
D
 
N
S
 
T
H
 
Q
L
 
L
S
 
E
G
 
K
R
 
T
D
 
P
W
 
Y
L
 
L
V
 
G
G
 
G
L
 
N
Q
 
E
P
 
Y
T
 
S
I
 
I
A
 
A
D
 
D
V
 
I
A
 
A
I
 
V
Y
 
Y
S
 
P
Y
x
W
V
 
A
A
 
K
R
x
C
A
 
Y
P
 
E
E
 
H
G
 
Q
N
 
K
V
 
I
D
 
N
L
 
L
S
 
E
G
 
D
Y
 
Y
P
 
P
A
 
A
V
 
V
N
 
K
A
 
K
F
 
W
L
 
L
R
 
E
R
 
K
V
 
I
E
 
Q
G
 
Q
L
 
R
P
 
P

1pn9A Crystal structure of an insect delta-class glutathione s- transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
30% identity, 94% coverage: 1:191/204 of query aligns to 1:193/209 of 1pn9A

query
sites
1pn9A
M
 
M
K
 
D
L
 
F
Y
 
Y
H
 
Y
H
 
L
P
 
P
L
 
G
S
|
S
G
 
A
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
Q
L
 
M
F
 
T
V
 
A
S
 
A
L
 
A
L
 
V
G
 
G
L
 
V
P
 
E
H
 
L
E
 
N
L
 
L
V
 
K
E
 
L
V
 
T
D
 
D
L
|
L
K
 
M
A
 
K
G
 
G
A
 
E
H
|
H
K
 
M
T
 
K
P
 
P
E
 
E
F
 
F
L
 
L
A
 
K
L
 
L
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
C
V
x
I
P
 
P
V
 
T
L
 
L
D
 
V
D
 
D
D
 
N
G
 
G
V
 
F
V
 
A
V
 
L
S
 
W
D
x
E
S
|
S
N
x
R
A
 
A
I
 
I
L
 
Q
V
 
I
Y
 
Y
L
 
L
A
 
A
K
 
E
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
K
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
Q
N
 
K
A
 
R
A
 
A
A
 
V
V
 
V
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
x
M
G
 
G
E
 
T
V
 
L
A
x
Y
Y
 
Q
G
 
R
P
 
F
A
 
A
A
 
D
A
 
Y
R
 
H
L
x
Y
V
 
P
T
 
Q
V
 
I
F
|
F
G
 
A
A
 
K
G
 
Q
F
 
P
N
 
A
P
 
N
D
 
P
E
 
E
V
 
N
I
 
E
G
 
K
R
 
K
A
 
M
H
 
K
T
 
D
L
 
A
L
 
V
K
 
G
R
 
F
L
 
L
D
 
N
S
 
T
H
 
F
L
 
L
S
 
E
G
 
G
R
 
Q
D
 
E
W
 
Y
L
 
A
V
 
A
G
 
G
L
 
N
Q
 
D
P
 
L
T
 
T
I
 
I
A
 
A
D
 
D
V
 
L
A
 
S
I
 
L
Y
 
A
S
 
A
Y
 
T
V
 
I
A
 
A
R
 
T
A
 
Y
P
 
E
E
 
V
G
 
A
N
 
G
V
 
F
D
 
D
L
 
F
S
 
A
G
 
P
Y
 
Y
P
 
P
A
 
N
V
 
V
N
 
A
A
 
A
F
 
W
L
 
F
R
 
A
R
 
R
V
 
C
E
 
K
-
 
A
G
 
N
L
 
A
P
 
P
G
 
G
F
 
Y

Sites not aligning to the query:

6zb6D Crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione (see paper)
29% identity, 97% coverage: 1:197/204 of query aligns to 4:213/215 of 6zb6D

query
sites
6zb6D
M
 
V
K
 
K
L
 
V
Y
 
F
H
 
G
H
 
P
P
 
A
L
 
M
S
|
S
G
 
T
H
x
N
A
 
V
H
 
A
R
 
R
A
 
V
R
 
L
L
 
V
F
 
F
V
 
L
S
 
E
L
 
E
L
 
V
G
 
G
L
 
A
P
 
D
H
 
Y
E
 
E
L
 
V
V
 
V
E
 
D
V
 
M
D
 
D
L
 
F
K
 
K
A
 
V
G
 
M
A
 
E
H
 
H
K
|
K
T
 
S
P
 
P
E
 
E
F
 
H
L
 
L
A
 
A
L
 
R
N
 
N
P
 
P
F
 
F
G
|
G
Q
|
Q
V
x
I
P
|
P
V
 
A
L
 
F
D
 
Q
D
 
D
D
 
G
G
 
D
V
 
L
V
 
L
V
 
L
S
 
F
D
x
E
S
|
S
N
 
R
A
 
A
I
 
I
L
 
S
V
 
K
Y
 
Y
L
 
V
A
 
L
K
 
R
-
 
K
-
 
Y
K
 
K
A
 
T
G
 
G
R
 
E
S
 
V
D
 
D
W
 
L
L
 
L
P
 
R
E
 
E
-
 
G
D
 
N
A
 
L
R
 
K
N
 
E
A
 
A
A
 
A
A
 
M
V
 
V
Q
 
D
R
 
V
W
 
W
L
 
T
S
 
E
V
 
V
A
 
D
A
 
A
G
 
H
E
 
-
V
 
-
A
 
T
Y
 
Y
G
 
N
P
 
P
A
 
A
A
 
L
A
 
S
R
 
P
L
 
I
V
 
-
T
 
-
V
 
V
F
 
Y
G
 
Q
A
 
C
G
 
L
F
 
F
N
 
N
P
 
P
-
 
M
-
 
M
-
 
R
-
 
G
-
 
I
-
 
P
-
 
T
-
 
D
D
 
E
E
 
K
V
 
V
I
 
V
G
 
A
R
 
E
A
 
S
H
 
L
T
 
E
L
 
K
L
 
L
K
 
K
R
 
K
L
 
V
-
 
L
-
 
E
-
 
V
-
 
Y
D
 
E
S
 
A
H
 
R
L
 
L
S
 
S
G
 
Q
R
 
H
D
 
E
W
 
Y
L
 
L
V
 
A
G
 
G
L
 
D
Q
 
F
P
 
V
T
 
S
I
 
F
A
 
A
D
 
D
V
 
L
A
 
N
-
 
H
-
 
F
I
 
P
Y
 
Y
S
 
T
Y
 
F
V
 
Y
A
 
F
R
 
M
A
 
A
P
 
T
E
 
P
G
 
H
N
 
A
V
 
A
D
 
L
L
 
F
S
 
G
G
 
S
Y
 
Y
P
 
P
A
 
H
V
 
V
N
 
K
A
 
A
F
 
W
L
 
W
R
 
E
R
 
R
V
 
I
E
 
M
G
 
A
L
 
R
P
 
P
G
 
A
F
 
I
V
 
K
P
 
K
F
 
I
A
 
S
Q
 
A
T
 
T

7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1
28% identity, 90% coverage: 3:186/204 of query aligns to 10:194/215 of 7rhpA

query
sites
7rhpA
L
 
F
Y
 
Y
H
 
Q
H
 
L
P
 
P
L
 
G
S
|
S
G
 
P
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
A
L
 
L
F
 
T
V
 
A
S
 
A
L
 
A
L
 
L
G
 
D
L
 
I
P
 
E
H
 
M
E
 
N
L
 
F
V
 
K
E
 
Q
V
 
V
D
 
N
L
|
L
K
 
M
A
 
N
G
 
G
A
 
E
H
|
H
K
 
L
T
 
K
P
 
P
E
 
E
F
 
F
L
 
L
A
 
K
L
 
I
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
x
I
P
|
P
V
 
T
L
 
I
D
 
D
D
 
D
D
 
N
G
 
G
V
 
F
V
 
R
V
 
L
S
 
W
D
x
E
S
|
S
N
 
R
A
 
A
I
 
I
L
 
M
V
 
T
Y
 
Y
L
 
L
A
 
A
K
 
D
K
 
Q
A
 
Y
G
 
G
R
 
K
S
 
N
D
 
D
W
 
T
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
L
R
 
K
N
 
K
A
 
R
A
 
A
A
 
I
V
 
V
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
 
M
G
 
C
E
 
S
V
 
L
A
 
Y
Y
 
K
G
 
S
P
 
F
A
 
M
A
 
D
A
 
Y
R
 
Y
L
 
Y
V
 
P
T
 
I
V
 
I
F
 
F
G
 
M
A
 
K
G
 
A
F
 
V
N
 
K
P
 
D
D
 
Q
E
 
A
V
 
K
I
 
Y
G
 
E
R
 
N
A
 
I
H
 
G
T
 
T
L
 
A
L
 
L
K
 
S
R
 
F
L
 
L
D
 
D
S
 
K
H
 
F
L
 
L
S
 
E
G
 
G
R
 
E
D
 
N
W
 
Y
L
 
V
V
 
A
G
 
G
L
 
K
Q
 
N
P
 
M
T
 
T
I
 
L
A
 
A
D
 
D
V
 
L
A
 
S
I
 
I
Y
 
V
S
 
S
Y
 
T
V
 
V
A
 
S
R
 
T
A
 
L
P
 
E
E
 
A
G
 
L
N
 
D
V
 
Y
D
 
D
L
 
L
S
 
S
G
 
K
Y
 
Y
P
 
K
A
 
N
V
 
V
N
 
T
A
 
R
F
 
W
L
 
F
R
 
A
R
 
K
V
 
I
E
 
K

6zb6C Crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione (see paper)
29% identity, 97% coverage: 1:197/204 of query aligns to 4:213/227 of 6zb6C

query
sites
6zb6C
M
 
V
K
 
K
L
 
V
Y
 
F
H
 
G
H
 
P
P
 
A
L
 
M
S
|
S
G
x
T
H
x
N
A
 
V
H
 
A
R
 
R
A
 
V
R
 
L
L
 
V
F
 
F
V
 
L
S
 
E
L
 
E
L
 
V
G
 
G
L
 
A
P
 
D
H
 
Y
E
 
E
L
 
V
V
 
V
E
 
D
V
 
M
D
 
D
L
 
F
K
 
K
A
 
V
G
 
M
A
 
E
H
|
H
K
|
K
T
 
S
P
 
P
E
 
E
F
 
H
L
 
L
A
 
A
L
 
R
N
 
N
P
 
P
F
 
F
G
|
G
Q
|
Q
V
x
I
P
|
P
V
 
A
L
 
F
D
 
Q
D
 
D
D
 
G
G
 
D
V
 
L
V
 
L
V
 
L
S
 
F
D
x
E
S
|
S
N
 
R
A
 
A
I
 
I
L
 
S
V
 
K
Y
 
Y
L
 
V
A
 
L
K
 
R
-
 
K
-
 
Y
K
 
K
A
 
T
G
 
G
R
 
E
S
 
V
D
 
D
W
 
L
L
 
L
P
 
R
E
 
E
-
 
G
D
 
N
A
 
L
R
 
K
N
 
E
A
 
A
A
 
A
A
 
M
V
 
V
Q
 
D
R
 
V
W
 
W
L
 
T
S
 
E
V
 
V
A
 
D
A
 
A
G
 
H
E
 
-
V
 
-
A
 
T
Y
 
Y
G
 
N
P
 
P
A
 
A
A
 
L
A
 
S
R
 
P
L
 
I
V
 
-
T
 
-
V
 
V
F
 
Y
G
 
Q
A
 
C
G
 
L
F
|
F
N
 
N
P
 
P
-
 
M
-
x
M
-
 
R
-
 
G
-
 
I
-
 
P
-
 
T
-
 
D
D
 
E
E
 
K
V
 
V
I
 
V
G
 
A
R
 
E
A
 
S
H
 
L
T
 
E
L
 
K
L
 
L
K
 
K
R
 
K
L
 
V
-
 
L
-
 
E
-
 
V
-
 
Y
D
 
E
S
 
A
H
 
R
L
 
L
S
 
S
G
 
Q
R
 
H
D
 
E
W
 
Y
L
 
L
V
 
A
G
 
G
L
 
D
Q
 
F
P
 
V
T
 
S
I
 
F
A
 
A
D
 
D
V
 
L
A
 
N
-
 
H
-
 
F
I
 
P
Y
 
Y
S
 
T
Y
 
F
V
 
Y
A
 
F
R
 
M
A
 
A
P
 
T
E
 
P
G
 
H
N
 
A
V
 
A
D
 
L
L
 
F
S
 
G
G
 
S
Y
 
Y
P
 
P
A
 
H
V
 
V
N
 
K
A
 
A
F
 
W
L
 
W
R
 
E
R
 
R
V
 
I
E
 
M
G
 
A
L
 
R
P
 
P
G
 
A
F
 
I
V
 
K
P
 
K
F
 
I
A
 
S
Q
 
A
T
 
T

4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 5:195/220 of 4gsnB

query
sites
4gsnB
L
 
L
Y
 
Y
H
 
T
H
 
L
P
 
H
L
 
L
S
|
S
G
 
P
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
E
L
 
L
F
 
T
V
 
A
S
 
K
L
 
A
L
 
L
G
 
G
L
 
L
P
 
E
H
 
L
E
 
E
L
 
Q
V
 
K
E
 
T
V
 
I
D
 
N
L
|
L
K
 
L
A
 
T
G
 
G
A
 
D
H
|
H
K
 
L
T
 
K
P
 
P
E
 
E
F
 
F
L
 
V
A
 
K
L
 
L
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
x
I
P
 
P
V
 
V
L
 
L
D
 
D
D
 
D
D
 
N
G
 
G
V
 
T
V
 
I
V
 
I
S
 
T
D
x
E
S
|
S
N
x
H
A
 
A
I
 
I
L
 
M
V
 
I
Y
 
Y
L
 
L
A
 
V
K
 
T
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
S
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
V
N
 
K
A
 
Q
A
 
A
A
 
R
V
 
V
Q
 
N
R
 
S
W
 
A
L
 
L
S
 
H
V
 
F
A
 
E
A
 
S
G
 
G
E
 
V
V
 
L
-
x
F
A
 
A
Y
 
R
G
 
M
P
x
R
A
 
F
A
 
T
A
 
F
R
 
E
L
 
R
V
 
I
T
 
L
V
 
F
F
 
F
G
 
G
A
 
K
G
 
S
F
 
D
N
 
I
P
 
P
D
 
E
E
 
D
V
 
R
I
 
V
G
 
E
R
 
Y
A
 
V
H
 
Q
T
 
K
L
 
S
L
 
Y
K
 
E
R
 
L
L
 
L
D
 
E
S
 
D
H
 
T
L
 
L
S
 
V
G
 
D
R
 
-
D
 
D
W
 
F
L
 
V
V
 
A
G
 
G
L
 
P
Q
 
T
P
 
M
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
S
I
 
C
Y
 
I
S
 
S
Y
 
T
V
 
V
A
 
S
R
 
-
A
 
S
P
 
I
E
 
M
G
 
G
N
 
V
V
 
V
D
 
P
L
 
L
-
 
E
-
 
Q
S
 
S
G
 
K
Y
 
H
P
 
P
A
 
R
V
 
I
N
 
Y
A
 
A
F
 
W
L
 
I
R
 
D
R
 
R
V
 
L
E
 
K
G
 
Q
L
 
L
P
 
P
G
 
Y
F
 
Y

7rkaA Crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 (see paper)
32% identity, 80% coverage: 16:178/204 of query aligns to 17:182/211 of 7rkaA

query
sites
7rkaA
R
 
R
L
 
Q
F
 
A
V
 
L
S
 
E
L
 
Y
L
 
L
G
 
G
L
 
L
P
 
E
H
 
H
E
 
K
L
 
L
V
 
V
E
 
N
V
 
V
D
 
D
L
 
F
K
 
G
A
 
I
G
 
G
A
 
E
H
 
H
K
 
M
T
 
T
P
 
E
E
 
E
F
 
F
L
 
A
A
 
Q
L
 
K
N
 
N
P
 
P
F
 
Q
G
 
K
Q
 
E
V
x
I
P
|
P
V
 
V
L
 
L
D
 
D
D
 
D
D
 
N
G
 
G
V
 
F
V
 
L
V
 
L
S
 
G
D
x
E
S
|
S
N
 
N
A
 
A
I
 
I
L
 
L
V
 
Q
Y
 
Y
L
 
L
A
 
A
K
 
E
K
 
R
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
T
L
 
I
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
M
N
 
A
A
 
R
A
 
A
A
 
V
V
 
V
Q
 
N
R
 
H
W
 
R
L
 
L
S
 
C
V
 
F
A
 
N
A
 
L
G
 
S
E
 
T
V
 
Y
A
 
Y
Y
 
R
G
 
Y
P
 
I
A
 
S
A
 
E
A
 
Y
R
 
T
L
 
L
V
 
A
T
 
P
V
 
M
F
 
F
G
 
F
A
 
D
G
 
Y
F
 
Q
N
 
R
P
 
T
D
 
P
E
 
L
V
 
G
I
 
L
G
 
K
R
 
K
A
 
T
H
 
H
T
 
I
L
 
A
L
 
L
K
 
D
R
 
N
L
 
F
D
 
N
S
 
T
H
 
Y
L
 
L
S
 
K
-
 
L
-
 
L
G
 
G
R
 
K
D
 
K
W
 
Y
L
 
A
V
 
A
G
 
G
L
 
E
Q
 
T
P
 
V
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
Q
I
 
L
Y
 
V
S
 
T
Y
 
A
V
 
T
A
 
M
R
 
C
A
 
L
P
 
E
E
 
A
G
 
I
N
 
N
V
 
F
D
 
D
L
 
I
S
 
S
G
 
P
Y
 
W
P
 
P
A
 
L
V
 
V

Sites not aligning to the query:

4nhwD Crystal structure of glutathione transferase smc00097 from sinorhizobium meliloti, target efi-507275, with one glutathione bound per one protein subunit
36% identity, 75% coverage: 39:191/204 of query aligns to 58:205/217 of 4nhwD

query
sites
4nhwD
K
 
K
T
 
S
P
 
P
E
 
G
F
 
F
L
 
L
A
 
A
L
 
I
N
 
N
P
 
P
F
 
M
G
|
G
Q
x
L
V
x
I
P
|
P
V
 
A
L
 
I
D
 
E
D
 
D
D
 
D
G
 
G
V
 
L
V
 
V
V
 
L
S
 
T
D
x
E
S
|
S
N
 
L
A
 
A
I
 
N
L
 
N
V
 
L
Y
 
Y
L
 
L
A
 
A
K
 
R
K
 
K
A
 
H
G
 
G
R
 
-
S
 
G
D
 
P
W
 
L
L
 
A
P
 
P
E
 
A
D
 
D
A
 
I
R
 
R
N
 
E
A
 
E
A
 
G
A
 
Q
V
 
I
Q
 
G
R
 
N
W
 
W
L
 
T
S
 
M
V
 
W
A
 
A
A
 
A
G
x
T
E
|
E
V
 
V
A
 
E
Y
 
-
G
 
-
P
 
P
A
 
H
A
 
A
A
 
V
R
 
K
L
 
I
V
 
V
T
 
L
V
 
A
F
 
-
G
 
-
A
 
-
G
 
-
F
 
-
N
 
H
P
 
D
D
 
N
E
 
E
V
 
I
I
 
A
G
 
A
R
 
C
A
 
A
H
 
R
T
 
S
L
 
L
L
 
E
K
 
K
R
 
A
-
 
F
-
 
A
-
 
V
L
 
L
D
 
E
S
 
T
H
 
H
L
 
L
S
 
A
G
 
E
R
 
R
D
 
D
W
 
Y
L
 
V
V
 
V
G
 
G
L
 
D
Q
 
R
P
 
F
T
 
T
I
 
V
A
 
A
D
 
D
V
 
L
A
 
N
I
 
L
Y
 
-
S
 
A
Y
 
E
V
 
V
A
 
F
R
 
R
A
 
Y
P
 
T
E
 
M
G
 
S
N
 
Q
V
 
T
D
 
D
L
 
L
-
 
F
S
 
K
G
 
R
Y
 
H
P
 
P
A
 
Q
V
 
V
N
 
K
A
 
A
F
 
W
L
 
L
R
 
A
R
 
R
V
 
C
E
 
Q
G
 
S
L
 
R
P
 
P
G
 
A
F
 
F

Sites not aligning to the query:

2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 5:195/220 of 2imkA

query
sites
2imkA
L
 
L
Y
 
Y
H
 
T
H
x
L
P
 
H
L
|
L
S
|
S
G
x
P
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
E
L
 
L
F
 
T
V
 
A
S
 
K
L
 
A
L
 
L
G
 
G
L
 
L
P
 
E
H
 
L
E
 
E
L
 
Q
V
 
K
E
 
T
V
 
I
D
 
N
L
|
L
K
 
L
A
 
T
G
 
G
A
 
D
H
|
H
K
 
L
T
 
K
P
 
P
E
 
E
F
 
F
L
 
V
A
 
K
L
 
L
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
x
I
P
|
P
V
 
V
L
 
L
D
 
D
D
 
D
D
 
N
G
 
G
V
 
T
V
 
I
V
 
I
S
 
T
D
x
E
S
|
S
N
x
H
A
 
A
I
 
I
L
 
M
V
 
I
Y
 
Y
L
 
L
A
 
V
K
 
T
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
S
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
V
N
 
K
A
 
Q
A
 
A
A
 
R
V
 
V
Q
 
N
R
 
S
W
 
A
L
 
L
S
 
H
V
 
F
A
 
E
A
 
S
G
 
G
E
 
V
V
 
L
-
x
F
A
 
A
Y
 
R
G
 
M
P
x
R
A
 
F
A
 
I
A
 
F
R
 
E
L
 
R
V
 
I
T
x
L
V
 
F
F
 
F
G
 
G
A
 
K
G
 
S
F
 
D
N
 
I
P
 
P
D
 
E
E
 
D
V
 
R
I
 
V
G
 
E
R
 
Y
A
 
V
H
 
Q
T
 
K
L
 
S
L
 
Y
K
 
E
R
 
L
L
 
L
D
 
E
S
 
D
H
 
T
L
 
L
S
 
V
G
 
D
R
 
-
D
 
D
W
 
F
L
 
V
V
 
A
G
 
G
L
 
P
Q
 
T
P
 
M
T
 
T
I
 
I
A
 
A
D
 
D
V
 
F
A
 
S
I
 
C
Y
 
I
S
 
S
Y
 
T
V
 
I
A
 
S
R
 
-
A
 
S
P
 
I
E
 
M
G
 
G
N
 
V
V
 
V
D
 
P
L
 
L
-
 
E
-
 
Q
S
 
S
G
 
K
Y
 
H
P
 
P
A
 
R
V
 
I
N
 
Y
A
 
A
F
 
W
L
 
I
R
 
D
R
 
R
V
 
L
E
 
K
G
 
Q
L
 
L
P
 
P
G
 
Y
F
 
Y

Sites not aligning to the query:

5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
28% identity, 87% coverage: 1:178/204 of query aligns to 1:179/207 of 5zwpA

query
sites
5zwpA
M
 
M
K
 
D
L
 
F
Y
 
Y
H
 
Y
H
 
L
P
 
P
L
 
G
S
 
S
G
 
A
H
x
P
A
 
C
H
 
R
R
 
S
A
 
V
R
 
L
L
 
M
F
 
T
V
 
A
S
 
K
L
 
A
L
 
L
G
 
G
L
 
I
P
 
E
H
 
L
E
 
N
L
 
K
V
 
K
E
 
L
V
 
L
D
 
N
L
|
L
K
 
Q
A
 
A
G
 
G
A
 
E
H
|
H
K
 
L
T
 
K
P
 
P
E
 
E
F
 
F
L
 
L
A
 
K
L
 
I
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
x
I
P
|
P
V
 
T
L
 
L
D
 
V
D
 
D
D
 
G
G
 
D
V
 
F
V
 
A
V
 
L
S
 
W
D
x
E
S
|
S
N
x
R
A
 
A
I
 
I
L
 
M
V
 
V
Y
 
Y
L
 
L
A
 
V
K
 
E
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
T
D
 
D
W
 
S
L
 
L
-
 
F
P
 
P
E
 
K
D
 
C
A
 
P
R
 
K
N
 
K
A
 
R
A
 
A
A
 
V
V
 
I
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
x
M
G
 
G
E
 
T
V
 
L
A
 
Y
Y
 
K
G
 
S
P
 
F
A
 
A
A
 
D
A
 
Y
R
 
Y
L
 
Y
V
 
P
T
 
Q
V
 
I
F
 
F
G
 
A
A
 
K
G
 
A
F
 
P
N
 
A
P
 
D
D
 
P
E
 
E
V
 
L
I
 
F
G
 
K
R
 
K
A
 
I
H
 
E
T
 
T
L
 
A
L
 
F
K
 
D
R
 
F
L
 
L
D
 
N
S
 
T
H
 
F
L
 
L
S
 
K
G
 
G
R
 
H
D
 
E
W
 
Y
L
 
A
V
 
A
G
 
G
L
 
D
Q
 
S
P
 
L
T
 
T
I
 
V
A
 
A
D
 
D
V
 
L
A
 
A
I
 
L
Y
 
L
S
 
A
Y
 
S
V
 
V
A
 
S
R
 
T
A
 
F
P
 
E
E
 
V
G
 
A
N
 
S
V
 
F
D
 
D
L
 
I
S
 
S
G
 
K
Y
 
Y
P
 
P
A
 
N
V
 
V

1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
29% identity, 91% coverage: 1:185/204 of query aligns to 1:186/207 of 1jlvA

query
sites
1jlvA
M
 
M
K
 
D
L
 
F
Y
 
Y
H
 
Y
H
 
L
P
 
P
L
 
G
S
|
S
G
 
A
H
x
P
A
 
C
H
 
R
R
 
A
A
 
V
R
 
Q
L
 
M
F
 
T
V
 
A
S
 
A
L
 
A
L
 
V
G
 
G
L
 
V
P
 
E
H
 
L
E
 
N
L
 
L
V
 
K
E
 
L
V
 
T
D
 
N
L
|
L
K
 
M
A
 
A
G
 
G
A
 
E
H
|
H
K
 
M
T
 
K
P
 
P
E
 
E
F
 
F
L
 
L
A
 
K
L
 
I
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
C
V
x
I
P
|
P
V
 
T
L
 
L
D
 
V
D
 
D
D
 
N
G
 
G
V
 
F
V
 
A
V
 
L
S
 
W
D
x
E
S
|
S
N
x
R
A
 
A
I
 
I
L
 
C
V
 
T
Y
 
Y
L
 
L
A
 
A
K
 
E
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
D
D
 
D
W
 
K
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
D
A
 
P
R
 
Q
N
 
K
A
 
R
A
 
A
A
 
V
V
 
V
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
x
M
G
 
G
E
 
T
V
 
L
A
 
Y
Y
 
Q
G
 
R
P
 
F
A
 
A
A
 
D
A
 
Y
R
 
Y
L
 
Y
V
 
P
T
 
Q
V
 
I
F
 
F
G
 
A
A
 
K
G
 
Q
F
 
P
N
 
A
P
 
N
D
 
A
E
 
E
V
 
N
I
 
E
G
 
K
R
 
K
A
 
M
H
 
K
T
 
D
L
 
A
L
 
V
K
 
D
R
 
F
L
 
L
D
 
N
S
 
T
H
 
F
L
 
L
S
 
D
G
 
G
R
 
H
D
 
K
W
 
Y
L
 
V
V
 
A
G
 
G
L
 
D
Q
 
S
P
 
L
T
 
T
I
 
I
A
 
A
D
 
D
V
 
L
A
 
T
I
 
V
Y
 
L
S
 
A
Y
 
T
V
 
V
A
 
S
R
 
T
A
 
Y
P
 
D
E
 
V
G
 
A
N
 
G
V
 
F
D
 
E
L
 
L
S
 
A
G
 
K
Y
 
Y
P
 
P
A
 
H
V
 
V
N
 
A
A
 
A
F
 
W
L
 
Y
R
 
E
R
 
R
V
 
T

4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
28% identity, 93% coverage: 3:191/204 of query aligns to 3:193/207 of 4i97A

query
sites
4i97A
L
 
L
Y
 
Y
H
 
Y
H
 
L
P
 
P
L
 
G
S
|
S
G
 
S
H
x
P
A
 
C
H
 
R
R
 
S
A
 
V
R
 
I
L
 
M
F
 
V
V
 
A
S
 
K
L
 
A
L
 
I
G
 
G
L
 
L
P
 
E
H
 
L
E
 
N
L
 
K
V
 
K
E
 
L
V
 
L
D
 
D
L
|
L
K
 
S
A
 
T
G
 
G
A
 
E
H
|
H
K
 
L
T
 
K
P
 
P
E
 
E
F
 
F
L
 
V
A
 
K
L
 
I
N
 
N
P
 
P
F
 
Q
G
x
H
Q
x
T
V
x
I
P
 
P
V
 
T
L
 
L
D
 
V
D
 
D
D
 
N
G
 
G
V
 
F
V
 
A
V
 
L
S
 
W
D
x
E
S
|
S
N
x
R
A
 
A
I
 
I
L
 
L
V
 
V
Y
 
Y
L
 
L
A
 
V
K
 
E
K
 
K
A
 
Y
G
 
G
R
 
K
S
 
T
D
 
D
W
 
S
L
 
L
-
 
Y
P
 
P
E
 
K
D
 
C
A
 
P
R
 
K
N
 
K
A
 
R
A
 
A
A
 
V
V
 
I
Q
 
N
R
 
Q
W
 
R
L
 
L
S
 
Y
V
 
F
A
 
D
A
 
M
G
 
G
E
 
T
V
 
L
A
 
Y
Y
 
Q
G
 
S
P
 
F
A
 
A
A
 
N
A
 
Y
R
 
Y
L
 
Y
V
 
P
T
 
Q
V
 
V
F
 
F
G
 
A
A
 
K
G
 
A
F
 
P
N
 
A
P
 
D
D
 
P
E
 
E
V
 
L
I
 
Y
G
 
K
R
 
K
A
 
M
H
 
E
T
 
A
L
 
A
L
 
V
K
 
E
R
 
F
L
 
L
D
 
N
S
 
T
H
 
F
L
 
L
S
 
E
G
 
G
R
 
Q
D
 
T
W
 
Y
L
 
A
V
 
A
G
 
G
L
 
D
Q
 
S
P
 
L
T
 
T
I
 
I
A
 
A
D
 
D
V
 
I
A
 
A
I
 
L
Y
 
L
S
 
A
Y
 
T
V
 
M
A
 
S
R
 
S
A
 
F
P
 
E
E
 
V
G
 
A
N
 
G
V
 
Y
D
 
D
L
 
F
S
 
S
G
 
K
Y
 
Y
P
 
E
A
 
N
V
 
V
N
 
N
A
 
K
F
 
W
L
 
Y
R
 
A
R
 
N
V
 
A
E
 
K
G
 
K
L
 
V
-
 
T
P
 
P
G
 
G
F
 
W

Query Sequence

>AZOBR_RS27895 AZOBR_RS27895 glutathione S-transferase
MKLYHHPLSGHAHRARLFVSLLGLPHELVEVDLKAGAHKTPEFLALNPFGQVPVLDDDGV
VVSDSNAILVYLAKKAGRSDWLPEDARNAAAVQRWLSVAAGEVAYGPAAARLVTVFGAGF
NPDEVIGRAHTLLKRLDSHLSGRDWLVGLQPTIADVAIYSYVARAPEGNVDLSGYPAVNA
FLRRVEGLPGFVPFAQTPAGLTAA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory