Comparing AZOBR_RS27895 FitnessBrowser__azobra:AZOBR_RS27895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
35% identity, 95% coverage: 2:194/204 of query aligns to 4:199/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
36% identity, 94% coverage: 1:191/204 of query aligns to 2:195/206 of 4hz2B
4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
34% identity, 86% coverage: 16:191/204 of query aligns to 19:198/223 of 4pngB
Sites not aligning to the query:
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
32% identity, 94% coverage: 1:191/204 of query aligns to 3:195/214 of 3wywB
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
34% identity, 96% coverage: 1:196/204 of query aligns to 2:209/213 of 5f06A
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
33% identity, 94% coverage: 1:191/204 of query aligns to 2:177/183 of 8ai8A
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
33% identity, 94% coverage: 1:191/204 of query aligns to 2:177/183 of 7pkaA
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
35% identity, 86% coverage: 16:191/204 of query aligns to 18:197/221 of 4pnfB
Sites not aligning to the query:
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 8:198/222 of 3zmkB
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
29% identity, 93% coverage: 1:189/204 of query aligns to 1:196/203 of 4l8eA
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
30% identity, 94% coverage: 1:191/204 of query aligns to 1:193/209 of 1pn9A
Sites not aligning to the query:
6zb6D Crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione (see paper)
29% identity, 97% coverage: 1:197/204 of query aligns to 4:213/215 of 6zb6D
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
28% identity, 90% coverage: 3:186/204 of query aligns to 10:194/215 of 7rhpA
6zb6C Crystal structure of lolium rigidum gstf in complex with s-(p- nitrobenzyl) glutathione (see paper)
29% identity, 97% coverage: 1:197/204 of query aligns to 4:213/227 of 6zb6C
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 5:195/220 of 4gsnB
7rkaA Crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 (see paper)
32% identity, 80% coverage: 16:178/204 of query aligns to 17:182/211 of 7rkaA
4nhwD Crystal structure of glutathione transferase smc00097 from sinorhizobium meliloti, target efi-507275, with one glutathione bound per one protein subunit
36% identity, 75% coverage: 39:191/204 of query aligns to 58:205/217 of 4nhwD
Sites not aligning to the query:
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
32% identity, 93% coverage: 3:191/204 of query aligns to 5:195/220 of 2imkA
Sites not aligning to the query:
5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
28% identity, 87% coverage: 1:178/204 of query aligns to 1:179/207 of 5zwpA
1jlvA Anopheles dirus species b glutathione s-transferases 1-3 (see paper)
29% identity, 91% coverage: 1:185/204 of query aligns to 1:186/207 of 1jlvA
>AZOBR_RS27895 FitnessBrowser__azobra:AZOBR_RS27895
MKLYHHPLSGHAHRARLFVSLLGLPHELVEVDLKAGAHKTPEFLALNPFGQVPVLDDDGV
VVSDSNAILVYLAKKAGRSDWLPEDARNAAAVQRWLSVAAGEVAYGPAAARLVTVFGAGF
NPDEVIGRAHTLLKRLDSHLSGRDWLVGLQPTIADVAIYSYVARAPEGNVDLSGYPAVNA
FLRRVEGLPGFVPFAQTPAGLTAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory