SitesBLAST
Comparing AZOBR_RS28175 FitnessBrowser__azobra:AZOBR_RS28175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
53% identity, 98% coverage: 4:249/251 of query aligns to 3:249/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ G37), L37 (≠ R38), C61 (≠ A62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), T140 (= T140), S142 (= S142), Y155 (= Y155), K159 (= K159), A186 (= A186), V187 (≠ I187)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 97% coverage: 4:247/251 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G17), S142 (= S142), I152 (≠ N152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V213), R211 (≠ G214), R212 (= R215)
- binding bicarbonate ion: I92 (= I93), G94 (vs. gap), R109 (= R109), R179 (= R179), S228 (= S231)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ T15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (≠ G37), I37 (≠ R38), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T140), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (= A186), I188 (= I188), T190 (= T190)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 97% coverage: 4:247/251 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G17), S142 (= S142), I152 (≠ N152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I93), S93 (vs. gap), G94 (vs. gap), E95 (≠ H94), T97 (≠ R97), E101 (≠ D101), T103 (= T103), Q106 (≠ D106), R109 (= R109), S175 (≠ K175), G177 (= G177)
- binding magnesium ion: S237 (≠ Q240), Y238 (≠ S241)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ T15), N15 (≠ S16), G16 (= G17), I17 (= I18), D36 (≠ G37), I37 (≠ R38), W41 (≠ E42), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T140), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (= I188), T190 (= T190)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 97% coverage: 4:247/251 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G17), S142 (= S142), I152 (≠ N152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S16), G16 (= G17), I17 (= I18), N89 (= N90), G91 (= G92), Y155 (= Y155), P185 (= P185), A186 (= A186)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
42% identity, 96% coverage: 8:249/251 of query aligns to 7:246/248 of 6ixmC
- active site: G16 (= G17), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G16 (= G17), I17 (= I18), D36 (≠ G37), I37 (≠ R38), A61 (= A62), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), M140 (≠ T140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (= A186), Y187 (≠ I187), I188 (= I188), L192 (≠ M192)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
39% identity, 96% coverage: 9:248/251 of query aligns to 4:237/239 of 3sj7A
- active site: G12 (= G17), S138 (= S142), Q148 (≠ N152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ T15), R11 (≠ S16), I13 (= I18), N31 (≠ T36), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (≠ G37), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ V113), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ A186)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 96% coverage: 9:248/251 of query aligns to 7:244/246 of 3osuA
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 4:250/251 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ N152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ T36), Y36 (≠ G37), N37 (≠ R38), G38 (≠ R39), S39 (≠ E40), N63 (≠ D63), V64 (= V64), N90 (= N90), A91 (= A91), I93 (= I93), I113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (= I188), T190 (= T190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 100% coverage: 1:251/251 of query aligns to 2:255/255 of 5itvA
- active site: G18 (= G17), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (= S16), G18 (= G17), I19 (= I18), D38 (≠ G37), I39 (≠ R38), T61 (≠ A62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (= T140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (≠ A186), I186 (= I187), I187 (= I188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 100% coverage: 1:250/251 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N114), S139 (= S142), Q149 (≠ N152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ G96), K98 (≠ D101), S139 (= S142), N146 (≠ L149), V147 (≠ A150), Q149 (≠ N152), Y152 (= Y155), F184 (≠ I187), M189 (= M192), K200 (≠ A206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ G37), F39 (≠ R38), V59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (= I93), T137 (= T140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ I187), T185 (≠ I188), T187 (= T190), M189 (= M192)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 98% coverage: 4:250/251 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ S16), G19 (= G17), I20 (= I18), D39 (≠ G37), R40 (= R38), C63 (≠ A62), I65 (≠ V64), N91 (= N90), G93 (= G92), I94 (= I93), V114 (= V113), Y155 (= Y155), K159 (= K159), I188 (= I188), T190 (= T190), T193 (≠ S193)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
37% identity, 99% coverage: 1:249/251 of query aligns to 1:247/249 of 4bmsF
- active site: S137 (= S142), H147 (≠ N152), Y150 (= Y155), K154 (= K159), Q195 (≠ E200)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (= R39), A59 (= A62), D60 (= D63), V61 (= V64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (= V113), S137 (= S142), Y150 (= Y155), K154 (= K159), G181 (≠ A186), I183 (= I188), T185 (= T190), I187 (≠ M192)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
41% identity, 99% coverage: 1:248/251 of query aligns to 1:244/247 of P73574
- A14 (≠ G14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A150) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K159) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ I187) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (= N204) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
37% identity, 99% coverage: 1:249/251 of query aligns to 1:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S142), H147 (≠ N152), Y150 (= Y155), L188 (≠ S193), L246 (= L248)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (= R38), R39 (= R39), D60 (= D63), V61 (= V64), N87 (= N90), S88 (≠ A91), G89 (= G92), V110 (= V113), T135 (= T140), S137 (= S142), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (≠ A186), A182 (≠ I187), I183 (= I188), T185 (= T190), S187 (≠ M192)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
38% identity, 98% coverage: 4:249/251 of query aligns to 8:251/258 of 4wecA
- active site: G21 (= G17), S143 (= S142), Q154 (≠ S153), Y157 (= Y155), K161 (= K159)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ T15), S20 (= S16), G21 (= G17), I22 (= I18), D41 (vs. gap), I42 (vs. gap), V61 (≠ A62), D62 (= D63), V63 (= V64), N89 (= N90), T141 (= T140), Y157 (= Y155), K161 (= K159), P187 (= P185), P189 (≠ I187), V190 (≠ I188)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
39% identity, 97% coverage: 8:250/251 of query aligns to 3:251/253 of 4nbwA
- active site: G12 (= G17), S146 (= S142), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), N11 (≠ S16), G12 (= G17), I13 (= I18), D32 (≠ G37), L33 (≠ R38), V57 (≠ A62), D58 (= D63), V59 (= V64), N85 (= N90), A86 (= A91), G87 (= G92), S146 (= S142), Y159 (= Y155), K163 (= K159), I192 (= I188), T194 (= T190)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
42% identity, 97% coverage: 8:250/251 of query aligns to 7:239/240 of 4dmmB
- active site: G16 (= G17), S142 (= S142), Q152 (≠ N152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ S16), G16 (= G17), I17 (= I18), A37 (≠ R38), S38 (≠ R39), S39 (≠ E40), A62 (= A62), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), L113 (≠ V113), I140 (≠ T140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (≠ A186), I188 (= I188), T190 (= T190), M192 (= M192)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
38% identity, 97% coverage: 8:250/251 of query aligns to 3:244/244 of 1edoA
- active site: G12 (= G17), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ T15), R11 (≠ S16), I13 (= I18), N31 (≠ T36), Y32 (≠ G37), A33 (≠ R38), R34 (= R39), S35 (≠ E40), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ A186), I184 (= I188), S186 (≠ T190), M188 (= M192)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
40% identity, 98% coverage: 3:249/251 of query aligns to 10:255/257 of 5h5xC
- active site: G24 (= G17), S151 (= S142), Y164 (= Y155), K168 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), S23 (= S16), G24 (= G17), I25 (= I18), D44 (≠ G37), F45 (≠ R38), L69 (≠ A62), D70 (= D63), N97 (= N90), A98 (= A91), Y164 (= Y155), K168 (= K159), P194 (= P185), G195 (≠ A186), I197 (= I188), T199 (= T190)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 96% coverage: 8:249/251 of query aligns to 9:244/252 of 6vspB
Query Sequence
>AZOBR_RS28175 FitnessBrowser__azobra:AZOBR_RS28175
MTDMSGGVALVTGGTSGIGRATALAFAKAGATAIVTGRREAEGLETVDLVRQAGGRAVFV
QADVADAEEVAALFARIERDHGRLDYAFNNAGIHFGRSVADTTEADFDRMVAVNIKGVWL
CLKHELPIMLRQGKGAIVSTGSVLGQIGLAGNSVYSASKAAVEGMTRSVAIEVAKSGVRV
NAVCPAIIQTPMSAGSFGGEEAVNAALGPLHPVGRVGQPREVADTVVWLCSDAASFITGQ
SINVDGGLTVQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory