SitesBLAST
Comparing AZOBR_RS29190 FitnessBrowser__azobra:AZOBR_RS29190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
42% identity, 97% coverage: 5:294/300 of query aligns to 4:293/298 of P0A9V8
- QM 11:12 (≠ AM 12:13) binding
- D31 (= D32) binding
- L65 (= L66) binding
- T96 (= T97) binding
- G122 (= G123) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (= R124) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ L125) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NNYLA 175:179) binding
- K240 (= K241) binding
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
42% identity, 97% coverage: 5:294/300 of query aligns to 3:292/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
42% identity, 97% coverage: 5:294/300 of query aligns to 3:292/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), Q10 (≠ A12), M11 (= M13), F29 (= F31), D30 (= D32), V31 (≠ L33), M63 (= M65), L64 (= L66), V73 (= V75), S94 (= S96), T95 (= T97), R122 (= R124)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
38% identity, 93% coverage: 3:281/300 of query aligns to 2:286/298 of Q9I5I6
- 2:31 (vs. 3:32, 53% identical) binding
- P66 (= P67) binding
- T96 (= T97) binding ; mutation to A: Almost abolished activity.
- S122 (≠ G123) mutation to A: Strongly reduced activity.
- K171 (= K172) active site
- N175 (= N176) mutation to A: Strongly reduced activity.
- W214 (≠ G215) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K241) binding ; mutation to A: Almost abolished activity.
- D247 (= D242) mutation to A: Almost abolished activity.
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
38% identity, 93% coverage: 3:281/300 of query aligns to 1:284/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), H10 (≠ A12), M11 (= M13), F29 (= F31), D30 (= D32), L31 (= L33), M63 (= M65), L64 (= L66), P65 (= P67), T94 (= T97), V119 (= V122), G121 (≠ R124), F237 (= F234), K244 (= K241)
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
38% identity, 93% coverage: 3:281/300 of query aligns to 2:285/295 of 3obbA
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
33% identity, 94% coverage: 5:286/300 of query aligns to 41:328/335 of P29266
- D68 (= D32) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K172) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N176) mutation to Q: Decrease in activity.
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
30% identity, 94% coverage: 3:283/300 of query aligns to 4:285/294 of 5je8B
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
34% identity, 85% coverage: 5:258/300 of query aligns to 16:265/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (≠ D32), R44 (≠ L33), T45 (≠ D34), K48 (= K37), M76 (= M65), V77 (≠ L66), S78 (≠ P67), D82 (≠ Q71), Q85 (≠ E74), V133 (= V122), F241 (= F234), K242 (≠ T235), H245 (≠ L238), K248 (= K241)
- binding sulfate ion: T134 (≠ G123), G135 (≠ R124), K183 (= K172)
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
32% identity, 94% coverage: 5:286/300 of query aligns to 3:290/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), N10 (≠ A12), M11 (= M13), Y29 (≠ F31), D30 (= D32), V31 (≠ L33), M63 (= M65), L64 (= L66), P65 (= P67), T95 (= T97), V120 (= V122), G122 (≠ R124), F238 (= F234), K245 (= K241)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
32% identity, 94% coverage: 5:286/300 of query aligns to 42:329/336 of P31937
- LP 103:104 (= LP 66:67) binding
- N108 (≠ Q71) binding
- T134 (= T97) binding
- K284 (= K241) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
35% identity, 94% coverage: 4:284/300 of query aligns to 3:282/287 of 3pduA
- binding glycerol: R242 (≠ M244), E246 (≠ T248), E246 (≠ T248), R250 (= R254)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (≠ D32), R32 (≠ L33), N33 (≠ D34), M64 (= M65), L65 (= L66), A66 (≠ P67), A70 (≠ Q71), T96 (= T97), V121 (= V122), G123 (≠ R124), T124 (≠ L125), K171 (= K172), S231 (≠ G233), F232 (= F234), P233 (≠ T235), H236 (≠ L238), K239 (= K241)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
33% identity, 85% coverage: 5:258/300 of query aligns to 16:268/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G9), L21 (= L10), G22 (= G11), I23 (≠ A12), M24 (= M13), N43 (≠ D32), R44 (≠ L33), T45 (≠ D34), K48 (= K37), V77 (≠ L66), S78 (≠ P67), D82 (≠ Q71), Q85 (≠ E74), V133 (= V122), F244 (= F234), K245 (≠ T235), H248 (≠ L238), K251 (= K241)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
36% identity, 94% coverage: 2:284/300 of query aligns to 1:282/287 of 3pefA
- binding glycerol: D67 (≠ A68), G123 (≠ R124), K171 (= K172), N175 (= N176), M178 (≠ I181), L203 (≠ K204), G207 (= G208), N213 (= N214), A217 (≠ Q218), F232 (= F234), H236 (≠ L238), K239 (= K241), R242 (≠ M244), R269 (= R271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), I11 (≠ A12), M12 (= M13), N31 (≠ D32), R32 (≠ L33), S33 (≠ D34), K36 (= K37), M64 (= M65), L65 (= L66), A66 (≠ P67), A70 (≠ Q71), E73 (= E74), T96 (= T97), V121 (= V122), G123 (≠ R124), S124 (≠ L125), A231 (≠ G233), F232 (= F234), H236 (≠ L238), K239 (= K241)
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
36% identity, 94% coverage: 4:284/300 of query aligns to 2:284/292 of 5y8iA
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
36% identity, 94% coverage: 4:284/300 of query aligns to 3:285/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ E133), E149 (≠ N153), A152 (≠ G156), G153 (≠ T157), G153 (≠ T157), K154 (≠ T158)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (≠ G123), G120 (≠ R124), W211 (≠ G215), F236 (= F234)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G10 (= G11), N11 (≠ A12), M12 (= M13), F30 (= F31), D31 (= D32), P32 (≠ L33), M64 (= M65), L65 (= L66), T93 (= T97), G121 (≠ L125), K168 (= K172), L240 (= L238), K243 (= K241)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
36% identity, 94% coverage: 4:284/300 of query aligns to 3:285/290 of 5y8kA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
36% identity, 94% coverage: 4:284/300 of query aligns to 2:284/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ E149), E148 (≠ N153), A151 (≠ G156), K153 (≠ T158)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G9 (= G11), N10 (≠ A12), M11 (= M13), F29 (= F31), D30 (= D32), P31 (≠ L33), M63 (= M65), L64 (= L66), G120 (≠ L125), L239 (= L238), K242 (= K241)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
31% identity, 82% coverage: 3:247/300 of query aligns to 1:239/288 of 1wp4A
- active site: S116 (≠ G123), K164 (= K172), N167 (= N175), N168 (= N176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), L8 (= L10), G9 (= G11), A10 (= A12), M11 (= M13), N29 (≠ F31), R30 (≠ D32), T31 (≠ L33), K34 (≠ G36), C61 (≠ M65), L62 (= L66), P63 (= P67), E67 (≠ Q71), S90 (≠ T97), V115 (= V122), T225 (≠ D229), F226 (≠ T230), K233 (= K241)
- binding sulfate ion: S116 (≠ G123), G117 (≠ R124), G118 (≠ L125), K164 (= K172)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 82% coverage: 3:247/300 of query aligns to 2:240/289 of 2cvzC
- active site: S117 (≠ G123), K165 (= K172), N168 (= N175), N169 (= N176)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), L9 (= L10), G10 (= G11), A11 (= A12), M12 (= M13), N30 (≠ F31), R31 (≠ D32), T32 (≠ L33), C62 (≠ M65), L63 (= L66), P64 (= P67), E68 (≠ Q71), E71 (= E74), S91 (≠ T97), V116 (= V122), F227 (≠ T230), K234 (= K241)
Query Sequence
>AZOBR_RS29190 FitnessBrowser__azobra:AZOBR_RS29190
MSETIAFIGLGAMGLPMASNLVRKNFSVIGFDLDQGKLDKLVALGARPAGDVTAAVRDAT
VVITMLPAPPQVREVILGGAGVLAGLRPGSLVIDMSTVDPQTTDTVAAACLEKGIAFVDA
PVGRLVSHAERGESLFMVGASDAGFARAEPMLNAMGTTVHRCGPEGAGTRMKIVNNYLAV
IGAQLTAEAILLGTKLGLPVDVMKAVSGGTTATNGQFQINFATKVLKGDTAPGFTIDLAH
KDLMLALTAAAQQRLGLPVGLAAAGALGAARGGAYAQRDFSALLDYACDIAGVTPPRLPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory