Comparing AZOBR_RS29215 FitnessBrowser__azobra:AZOBR_RS29215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 93% coverage: 9:250/261 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 93% coverage: 9:250/261 of query aligns to 4:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 93% coverage: 9:250/261 of query aligns to 2:235/240 of 6mjpA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
28% identity, 94% coverage: 14:259/261 of query aligns to 11:235/353 of 1vciA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 86% coverage: 9:232/261 of query aligns to 4:222/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 83% coverage: 17:233/261 of query aligns to 9:218/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 90% coverage: 9:243/261 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 90% coverage: 9:243/261 of query aligns to 3:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 90% coverage: 9:243/261 of query aligns to 3:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 90% coverage: 9:243/261 of query aligns to 3:230/242 of 2oljA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 92% coverage: 9:248/261 of query aligns to 4:231/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 92% coverage: 9:248/261 of query aligns to 4:231/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 92% coverage: 9:248/261 of query aligns to 2:229/253 of 6z5uK
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 90% coverage: 9:243/261 of query aligns to 2:228/241 of 4u00A
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 95% coverage: 5:251/261 of query aligns to 2:239/240 of 1ji0A
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
29% identity, 94% coverage: 10:254/261 of query aligns to 4:245/262 of 7chaI
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
26% identity, 87% coverage: 17:242/261 of query aligns to 34:254/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
26% identity, 87% coverage: 17:242/261 of query aligns to 34:254/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
26% identity, 87% coverage: 17:242/261 of query aligns to 34:254/260 of 7ahdC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
26% identity, 89% coverage: 12:242/261 of query aligns to 6:232/353 of 1oxvD
>AZOBR_RS29215 FitnessBrowser__azobra:AZOBR_RS29215
MITGTNDIILEARGLSKEFGGFIAVKGVNLRVRRGTIHALIGPNGAGKSTVFNLLTKFLT
PTRGQILYKGRDITAMKPADVALLGMVRSFQISAVFPHLSVLENVRVALQRPRGTSFHFW
KPEASLHDLHDRAEELIEAVNLTPWAGHTAAELPYGRKRALEIATTLALDPEVMLLDEPL
AGMGHEDIEGTAALIKRVSADRTILMVEHNLSVVAHLSDTITVLRRGEILAEGAYDVVSR
NPQVMEAYMGTGAGTGEVGHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory