Comparing AZOBR_RS29665 FitnessBrowser__azobra:AZOBR_RS29665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
29% identity, 87% coverage: 23:355/381 of query aligns to 1:323/350 of 3td9A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
30% identity, 65% coverage: 24:271/381 of query aligns to 3:247/345 of 4n0qB
Sites not aligning to the query:
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
27% identity, 87% coverage: 24:355/381 of query aligns to 3:323/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
27% identity, 87% coverage: 24:355/381 of query aligns to 3:323/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
27% identity, 87% coverage: 24:355/381 of query aligns to 3:323/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
27% identity, 87% coverage: 24:355/381 of query aligns to 3:323/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
27% identity, 87% coverage: 24:355/381 of query aligns to 3:323/348 of 3ipcA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
25% identity, 94% coverage: 22:378/381 of query aligns to 1:340/348 of 4gnrA
4eygB Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with vanillic acid (see paper)
28% identity, 93% coverage: 21:374/381 of query aligns to 1:340/364 of 4eygB
1uskA L-leucine-binding protein with leucine bound (see paper)
24% identity, 82% coverage: 22:333/381 of query aligns to 1:302/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
24% identity, 82% coverage: 22:333/381 of query aligns to 1:302/345 of 1usiA
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4rv5A
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4obbA
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4rdcA
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4qymA
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4otzA
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4og2A
4oatA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4oatA
4nv3A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4nv3A
4nqrA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
24% identity, 92% coverage: 23:374/381 of query aligns to 2:350/364 of 4nqrA
>AZOBR_RS29665 FitnessBrowser__azobra:AZOBR_RS29665
MKTTALLLSAALLAPGVAFAQETIKIGVTQPLTGAVAASGNYVANGARVAEEVVNANGGV
LGKKIQLIIEDNKSNPKEAVASAEKLIVRDKVPVLMGAWSSTFTLAVMPKLVEYGVPMVV
ETSSSTKITTSGNPWVFRIAPTSAMEAKSFAEKLDHFQPAIQKADFLAVNNDFGRGSADE
FRKMLQAKGVKIGVTETMAPEATDLSAQLSSIKQSGGDTLFVTTGVEQITLILKQAAELR
LPHRVITNGGSSSPDQLIAQAGAAADGGYFTLFFAPWFPEKAVHPTVAKTFVDGWNKKGY
DFAGLTEGYRGYDGIMTIVEAIKKAGKAEPQAIRDALWTVKLDGVNGDIAFKKDGPEGKE
SGQNEANVYVVQVKDGKVTMP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory