Comparing AZOBR_RS29680 FitnessBrowser__azobra:AZOBR_RS29680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 91% coverage: 17:264/272 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 92% coverage: 17:265/272 of query aligns to 4:254/254 of 1g6hA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
35% identity, 91% coverage: 17:264/272 of query aligns to 6:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 92% coverage: 17:265/272 of query aligns to 2:236/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 91% coverage: 18:265/272 of query aligns to 3:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 91% coverage: 18:265/272 of query aligns to 3:236/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
31% identity, 92% coverage: 18:268/272 of query aligns to 4:240/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 91% coverage: 18:264/272 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 90% coverage: 18:263/272 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 90% coverage: 18:263/272 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 90% coverage: 18:262/272 of query aligns to 3:233/233 of 6b8bA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 83% coverage: 32:256/272 of query aligns to 20:232/343 of P30750
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 88% coverage: 16:255/272 of query aligns to 3:230/280 of 5x40A
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 83% coverage: 32:256/272 of query aligns to 21:233/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 83% coverage: 32:256/272 of query aligns to 21:233/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 83% coverage: 32:256/272 of query aligns to 21:233/344 of 3tuiC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 90% coverage: 20:265/272 of query aligns to 4:238/240 of 4ymuJ
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
29% identity, 85% coverage: 17:246/272 of query aligns to 4:222/501 of P04983
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 85% coverage: 15:246/272 of query aligns to 1:220/229 of 6z67B
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
32% identity, 86% coverage: 17:249/272 of query aligns to 4:220/285 of 4yerA
>AZOBR_RS29680 FitnessBrowser__azobra:AZOBR_RS29680
MSLALDESAAPILAGPVLEVREVAVHFSGLIAIASMSFAVPEGEIVSLIGPNGAGKTTAF
NVITGFLKPTGGKVLFRGTDLTRLSSNRIAGLGVVRTFQRTSIFAGCTVFDNVLTGMHRQ
GRAETWGALLRLASVRAETERMRAAVAEILAFVGLSHRADELAGNLAYGEQRLLGIAIAL
AADPKLLLLDEPAAGLNPSETEAFMGVVQRIRDRGVTILLVEHDMRMVMTISDRVVVLNH
GRIIAEGPPEVIRANPDVIQAYLGQGVKHAKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory