SitesBLAST
Comparing AZOBR_RS29700 FitnessBrowser__azobra:AZOBR_RS29700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
52% identity, 90% coverage: 6:151/162 of query aligns to 3:148/156 of 1ffuD
- binding flavin-adenine dinucleotide: S44 (≠ G47), H45 (≠ V48)
- binding fe2/s2 (inorganic) cluster: I39 (≠ L42), G40 (= G43), C41 (= C44), S44 (≠ G47), H45 (≠ V48), C46 (= C49), G47 (= G50), C49 (= C52), K59 (≠ R62), C61 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C135 (= C138), R136 (= R139), C137 (= C140)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
52% identity, 90% coverage: 6:151/162 of query aligns to 2:147/155 of 1ffvA
- binding flavin-adenine dinucleotide: T42 (≠ H46), S43 (≠ G47), H44 (≠ V48)
- binding fe2/s2 (inorganic) cluster: I38 (≠ L42), G39 (= G43), C40 (= C44), S43 (≠ G47), H44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), K58 (≠ R62), C60 (= C64), L97 (= L101), Q98 (= Q102), C99 (= C103), G100 (= G104), C102 (= C106), C134 (= C138), R135 (= R139), C136 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q102), C136 (= C140)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
54% identity, 88% coverage: 8:150/162 of query aligns to 6:148/162 of 1t3qA
- binding flavin-adenine dinucleotide: Q44 (≠ H46), G45 (= G47), V46 (= V48)
- binding fe2/s2 (inorganic) cluster: I40 (≠ L42), G41 (= G43), C42 (= C44), E43 (= E45), G45 (= G47), C47 (= C49), G48 (= G50), S49 (≠ A51), C50 (= C52), R60 (= R62), C62 (= C64), L99 (= L101), Q100 (= Q102), C101 (= C103), G102 (= G104), C104 (= C106), C136 (= C138), R137 (= R139), C138 (= C140)
- binding pterin cytosine dinucleotide: Q100 (= Q102), C138 (= C140)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
48% identity, 89% coverage: 8:151/162 of query aligns to 6:150/166 of P19921
- C42 (= C44) binding
- C47 (= C49) binding
- C50 (= C52) binding
- C62 (= C64) binding
- C102 (= C103) binding
- C105 (= C106) binding
- C137 (= C138) binding
- C139 (= C140) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
48% identity, 89% coverage: 8:151/162 of query aligns to 4:148/161 of 1n5wA
- binding flavin-adenine dinucleotide: T42 (≠ H46), S43 (≠ G47), H44 (≠ V48)
- binding fe2/s2 (inorganic) cluster: I38 (≠ L42), G39 (= G43), C40 (= C44), S43 (≠ G47), H44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), K58 (≠ R62), C60 (= C64), L98 (= L101), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C135 (= C138), R136 (= R139), C137 (= C140)
- binding pterin cytosine dinucleotide: Q99 (= Q102), C137 (= C140)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
46% identity, 89% coverage: 8:151/162 of query aligns to 12:154/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: I45 (≠ L42), G46 (= G43), C47 (= C44), S50 (≠ G47), N51 (≠ V48), C52 (= C49), G53 (= G50), C55 (= C52), C67 (= C64), Q105 (= Q102), C106 (= C103), G107 (= G104), C109 (= C106), C141 (= C138), R142 (= R139), C143 (= C140)
- binding pterin cytosine dinucleotide: Q105 (= Q102), C143 (= C140)
7dqxC Crystal structure of xanthine dehydrogenase family protein
44% identity, 97% coverage: 4:160/162 of query aligns to 2:159/160 of 7dqxC
- binding flavin-adenine dinucleotide: H44 (= H46), G45 (= G47)
- binding fe2/s2 (inorganic) cluster: C42 (= C44), E43 (= E45), G45 (= G47), V46 (= V48), C47 (= C49), C50 (= C52), R60 (= R62), C62 (= C64), Q100 (= Q102), C101 (= C103), C104 (= C106), C137 (= C138), C139 (= C140)
- binding pterin cytosine dinucleotide: Q100 (= Q102), C101 (= C103), C139 (= C140)
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
44% identity, 93% coverage: 8:157/162 of query aligns to 5:154/161 of 1sb3C
- binding flavin-adenine dinucleotide: G44 (= G47), E45 (≠ V48)
- binding fe2/s2 (inorganic) cluster: Q39 (≠ L42), G40 (= G43), C41 (= C44), G44 (= G47), E45 (≠ V48), C46 (= C49), G47 (= G50), C49 (= C52), L59 (≠ R62), C61 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C135 (= C138), R136 (= R139), C137 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C137 (= C140)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
40% identity, 92% coverage: 7:155/162 of query aligns to 5:153/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ H46), G45 (= G47), E46 (≠ V48)
- binding fe2/s2 (inorganic) cluster: E40 (≠ L42), G41 (= G43), C42 (= C44), S43 (≠ E45), G45 (= G47), E46 (≠ V48), C47 (= C49), G48 (= G50), C50 (= C52), T60 (≠ R62), C62 (= C64), Q100 (= Q102), C101 (= C103), G102 (= G104), C104 (= C106), C136 (= C138), C138 (= C140)
- binding pterin cytosine dinucleotide: Q100 (= Q102), C138 (= C140)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
40% identity, 92% coverage: 7:155/162 of query aligns to 5:153/157 of Q0QLF3
- C42 (= C44) binding
- C47 (= C49) binding
- C50 (= C52) binding
- C62 (= C64) binding
- C101 (= C103) binding
- C104 (= C106) binding
- C136 (= C138) binding
- C138 (= C140) binding
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
40% identity, 90% coverage: 7:152/162 of query aligns to 4:150/157 of 5y6qA
- binding flavin-adenine dinucleotide: G44 (= G47), Q45 (≠ V48)
- binding fe2/s2 (inorganic) cluster: K39 (≠ L42), G40 (= G43), C41 (= C44), D42 (≠ E45), G44 (= G47), C46 (= C49), G47 (= G50), C49 (= C52), C61 (= C64), F99 (≠ L101), Q100 (= Q102), C101 (= C103), G102 (= G104), C104 (= C106), C136 (= C138), R137 (= R139), C138 (= C140)
- binding pterin cytosine dinucleotide: Q100 (= Q102), C101 (= C103), C138 (= C140)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
37% identity, 89% coverage: 8:151/162 of query aligns to 63:221/229 of P77165
- C99 (= C44) binding
- C104 (= C49) binding
- G105 (= G50) binding
- C107 (= C52) binding
- C119 (= C64) binding
- C158 (= C103) binding
- C161 (= C106) binding
- C208 (= C138) binding
- C210 (= C140) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
37% identity, 89% coverage: 8:151/162 of query aligns to 12:170/175 of 5g5gA
- binding flavin-adenine dinucleotide: G51 (= G47), Q52 (≠ V48)
- binding fe2/s2 (inorganic) cluster: K46 (≠ L42), G47 (= G43), C48 (= C44), D49 (≠ E45), G51 (= G47), Q52 (≠ V48), C53 (= C49), G54 (= G50), C56 (= C52), N66 (≠ R62), C68 (= C64), Q106 (= Q102), C107 (= C103), G108 (= G104), C110 (= C106), C157 (= C138), C159 (= C140)
- binding pterin cytosine dinucleotide: Q106 (= Q102), C159 (= C140)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), Q44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 461, 498, 531, 532, 535, 536, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 501, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 697, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 256, 257, 258, 752, 753, 755
- binding bicarbonate ion: 460, 461, 498, 531, 532, 535, 536, 539, 884, 888, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 425, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 697, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), Q44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 461, 498, 531, 532, 535, 536, 539
- binding benzaldehyde: 255, 255, 394, 394, 425, 425, 425, 425, 494, 497, 497, 497, 501, 501, 531, 531, 535, 535, 626, 626, 626, 627, 694, 696, 697, 697, 869
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 697, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 461, 498, 531, 532, 535, 536, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), Q44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 425, 531, 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 425, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), Q44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 425, 531, 535, 622, 683, 696, 697, 869, 884, 888, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 425, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
38% identity, 87% coverage: 10:150/162 of query aligns to 6:149/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ L42), G39 (= G43), C40 (= C44), E41 (= E45), G43 (= G47), Q44 (≠ V48), C45 (= C49), G46 (= G50), C48 (= C52), R58 (= R62), C60 (= C64), Q99 (= Q102), C100 (= C103), G101 (= G104), C103 (= C106), C137 (= C138), R138 (= R139), C139 (= C140)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q102), C139 (= C140)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 425, 531, 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 531, 532, 533, 650, 653, 654, 655, 656, 660, 695, 696, 698, 699, 700, 701, 795, 797, 798, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>AZOBR_RS29700 FitnessBrowser__azobra:AZOBR_RS29700
MSAHAKTISLTVNGTRVEASVPPRQHLGDFLRERELLTGTHLGCEHGVCGACTILIDGEP
ARSCITFAVACDGRSVTTVEGLDDDPVATELREAFSAEHGLQCGFCTPGMLVAARDVVLR
RPDADNPAIRTAMSGNLCRCTGYVGIVNAIRRVIDARNTNAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory