SitesBLAST
Comparing AZOBR_RS29745 FitnessBrowser__azobra:AZOBR_RS29745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
48% identity, 100% coverage: 1:465/467 of query aligns to 6:465/465 of 3pm9A
- active site: A149 (= A146), L159 (≠ N156)
- binding flavin-adenine dinucleotide: P69 (= P64), Q70 (= Q65), G71 (= G66), G72 (= G67), N73 (= N68), T74 (= T69), G75 (= G70), L76 (= L71), G79 (≠ A74), Q80 (≠ S75), L91 (≠ T88), L133 (= L130), G134 (≠ A131), A135 (= A132), C139 (= C136), T140 (≠ Q137), G142 (= G139), G143 (= G140), S146 (≠ A143), T147 (= T144), A149 (= A146), G150 (= G147), E200 (= E197), G201 (= G198), I205 (= I202), I206 (≠ V203), E423 (= E423)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
37% identity, 97% coverage: 13:465/467 of query aligns to 25:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W28), P76 (= P64), G78 (= G66), G79 (= G67), N80 (= N68), T81 (= T69), G82 (= G70), M83 (≠ L71), G86 (≠ A74), S87 (= S75), L140 (= L130), A142 (= A132), C146 (= C136), H147 (≠ Q137), G150 (= G140), N151 (= N141), A153 (= A143), T154 (= T144), G208 (= G198), I212 (= I202), I213 (≠ V203), E423 (= E423), N460 (= N460)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
37% identity, 97% coverage: 13:465/467 of query aligns to 24:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R327), T337 (≠ P331), K348 (= K342), Y379 (≠ F375), H381 (= H377), H388 (= H384), H423 (= H424)
- binding flavin-adenine dinucleotide: W39 (= W28), P75 (= P64), Q76 (= Q65), G77 (= G66), G78 (= G67), N79 (= N68), T80 (= T69), G81 (= G70), M82 (≠ L71), G85 (≠ A74), S86 (= S75), L139 (= L130), G140 (≠ A131), A141 (= A132), C145 (= C136), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), G157 (= G148), G207 (= G198), I212 (≠ V203), E422 (= E423), N459 (= N460)
- binding zinc ion: H381 (= H377), H388 (= H384), E422 (= E423)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
37% identity, 97% coverage: 13:465/467 of query aligns to 24:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W28), P75 (= P64), G77 (= G66), G78 (= G67), N79 (= N68), T80 (= T69), G81 (= G70), G85 (≠ A74), S86 (= S75), L139 (= L130), G140 (≠ A131), A141 (= A132), C145 (= C136), H146 (≠ Q137), G148 (= G139), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), E206 (= E197), G207 (= G198), I211 (= I202), I212 (≠ V203), E422 (= E423), N459 (= N460)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R327), T337 (≠ P331), K348 (= K342), Y379 (≠ F375), H381 (= H377), H388 (= H384), H423 (= H424)
- binding zinc ion: H381 (= H377), H388 (= H384), E422 (= E423)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
37% identity, 97% coverage: 13:465/467 of query aligns to 24:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W28), P75 (= P64), G77 (= G66), G78 (= G67), N79 (= N68), T80 (= T69), G81 (= G70), G85 (≠ A74), S86 (= S75), L139 (= L130), G140 (≠ A131), A141 (= A132), C145 (= C136), H146 (≠ Q137), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), G157 (= G148), E206 (= E197), G207 (= G198), I211 (= I202), I212 (≠ V203), E422 (= E423), N459 (= N460)
- binding d-malate: M82 (≠ L71), R333 (= R327), T337 (≠ P331), K348 (= K342), Y379 (≠ F375), H381 (= H377), H388 (= H384), E422 (= E423), H423 (= H424)
- binding zinc ion: H381 (= H377), H388 (= H384), E422 (= E423)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
37% identity, 97% coverage: 13:465/467 of query aligns to 24:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R327), T337 (≠ P331), K348 (= K342), Y379 (≠ F375), H381 (= H377), H388 (= H384), N390 (= N386), H423 (= H424)
- binding flavin-adenine dinucleotide: W39 (= W28), P75 (= P64), G77 (= G66), G78 (= G67), N79 (= N68), T80 (= T69), G81 (= G70), M82 (≠ L71), G85 (≠ A74), S86 (= S75), L139 (= L130), G140 (≠ A131), A141 (= A132), C145 (= C136), G149 (= G140), N150 (= N141), A152 (= A143), T153 (= T144), A155 (= A146), G157 (= G148), G207 (= G198), I212 (≠ V203), E422 (= E423), H423 (= H424)
- binding zinc ion: H381 (= H377), H388 (= H384), E422 (= E423)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
37% identity, 97% coverage: 13:465/467 of query aligns to 77:517/521 of Q8N465
- S109 (≠ T45) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V63) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G67) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V85) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L91) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (= C110) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P127) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A143) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P169) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G171) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S316) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R327) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ P331) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ S340) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K342) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ N360) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ C367) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H377) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G379) to V: slight reduction in catalytic activity
- N439 (= N382) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H384) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N386) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I388) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A390) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E423) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H424) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G425) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 99% coverage: 2:465/467 of query aligns to 32:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 93% coverage: 31:466/467 of query aligns to 39:465/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P64), G75 (= G66), S76 (≠ G67), G77 (≠ N68), T78 (= T69), G79 (= G70), L80 (= L71), A83 (= A74), C84 (≠ S75), P137 (≠ A131), G138 (≠ A132), E139 (= E133), A142 (≠ C136), T143 (≠ Q137), G146 (= G140), N147 (= N141), S149 (≠ A143), T150 (= T144), A152 (= A146), G153 (= G147), E203 (= E197), G204 (= G198), I209 (≠ V203), E422 (= E423), H423 (= H424)
- binding fe (iii) ion: H377 (= H377), H384 (= H384), E422 (= E423)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 98% coverage: 8:465/467 of query aligns to 11:456/459 of P9WIT1
- K354 (≠ R354) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 92% coverage: 38:465/467 of query aligns to 42:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (vs. gap), E413 (= E423), H414 (= H424), N450 (= N460)
- binding lactic acid: R318 (= R327), H369 (= H377), H376 (= H384), H414 (= H424)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E413 (= E423)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
32% identity, 92% coverage: 38:465/467 of query aligns to 42:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L71), R317 (= R327), W321 (vs. gap), H368 (= H377), H375 (= H384), H413 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W321 (vs. gap), Y322 (vs. gap), E412 (= E423), H413 (= H424), N449 (= N460)
- binding manganese (ii) ion: H368 (= H377), H375 (= H384), E412 (= E423)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
32% identity, 92% coverage: 38:465/467 of query aligns to 42:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (= W324), E413 (= E423), H414 (= H424), N450 (= N460)
- binding 3-methyl-2-oxobutanoic acid: R318 (≠ S316), H369 (= H377), H376 (= H384), H414 (= H424)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E413 (= E423)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 92% coverage: 38:465/467 of query aligns to 42:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (≠ S316), W322 (= W324), H369 (= H377), H376 (= H384), H414 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (≠ T88), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (= W324), E413 (= E423), N450 (= N460)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E413 (= E423)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R327), H369 (= H377), H376 (= H384), H414 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (vs. gap), E413 (= E423), H414 (= H424), N450 (= N460)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E413 (= E423)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (≠ S316), W322 (= W324), H369 (= H377), H376 (= H384), H413 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (≠ T88), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W322 (= W324), E412 (= E423), H413 (= H424), N449 (= N460)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E412 (= E423)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (≠ S316), W322 (= W324), S336 (≠ K342), H369 (= H377), H376 (= H384), H413 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (≠ T88), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), E412 (= E423), N449 (= N460)
- binding manganese (ii) ion: H369 (= H377), H376 (= H384), E412 (= E423)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), W323 (= W324), E414 (= E423), H415 (= H424), N451 (= N460)
- binding manganese (ii) ion: H370 (= H377), H377 (= H384), E414 (= E423)
- binding pyruvic acid: R319 (≠ A320), H370 (= H377), H377 (= H384), H415 (= H424)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), Y324 (≠ R325), H370 (= H377), E414 (= E423), N451 (= N460)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (≠ A320), W323 (= W324), H415 (= H424)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
30% identity, 92% coverage: 38:465/467 of query aligns to 42:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (≠ A320), W323 (= W324), H370 (= H377), H415 (= H424)
- binding flavin-adenine dinucleotide: P68 (= P64), G70 (= G66), T71 (≠ G67), G72 (≠ N68), T73 (= T69), G74 (= G70), G78 (≠ A74), V79 (≠ S75), L90 (= L86), P132 (≠ L130), G133 (≠ A131), A134 (= A132), G140 (= G140), M141 (≠ N141), A143 (= A143), T144 (= T144), A146 (= A146), S147 (≠ G147), E200 (= E197), G201 (= G198), I206 (≠ V203), H370 (= H377), E414 (= E423), N451 (= N460)
Query Sequence
>AZOBR_RS29745 FitnessBrowser__azobra:AZOBR_RS29745
VLAPIRAIVGDRGLITDPDTMQPFMESWRDGWVGRSPAVVLPDSTEALAAVVRICAETRT
PIVPQGGNTGLTGASQPHADGTEIVLSTNRLNRIREIDIDNDTMTVEAGCILANIQNAAR
DIGRLFPMSLAAEGSCQIGGNIATNAGGVQVVRYGNMRNLVAGLEVVLPDGRIWDGLRGL
RKDNAGYDMKQIFIGSEGTLGIVTAAVLKLSPLPRATATALVAVSAPSDAVDLLTRAKGV
AGDRIITFELIQRDCIDVARRHVPDVPDPLRDRYPWYVLVELADQDGGNRLMEMLEGILE
AGMEAGEVLDGVVAASKAQADSLWRIREGIPEGQKREGVSFKHDVSVPISRVARFLDRAN
AALERECPGIRPFAFGHLGDGNIHFNPIQAEGGDPAEWKAKLATVNAIVHDIVVELGGSI
SAEHGIGRLRIDEMPRYKSAVELDMMATLKRAFDPHNIMNPGKILRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory