Comparing AZOBR_RS29770 FitnessBrowser__azobra:AZOBR_RS29770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
52% identity, 91% coverage: 29:356/361 of query aligns to 2:329/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
52% identity, 90% coverage: 31:356/361 of query aligns to 32:357/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
50% identity, 91% coverage: 27:353/361 of query aligns to 1:327/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
47% identity, 89% coverage: 29:348/361 of query aligns to 3:322/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
38% identity, 89% coverage: 32:351/361 of query aligns to 4:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 89% coverage: 32:351/361 of query aligns to 5:325/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 74% coverage: 1:268/361 of query aligns to 4:276/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
30% identity, 66% coverage: 32:268/361 of query aligns to 4:245/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
30% identity, 66% coverage: 32:268/361 of query aligns to 4:245/330 of 2zzvA
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
25% identity, 86% coverage: 29:339/361 of query aligns to 1:306/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 86% coverage: 30:339/361 of query aligns to 1:305/315 of 4uabA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
26% identity, 64% coverage: 52:281/361 of query aligns to 21:253/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 50% coverage: 32:210/361 of query aligns to 4:182/563 of 7e9yA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
26% identity, 71% coverage: 38:294/361 of query aligns to 38:285/328 of Q0B2F6
Sites not aligning to the query:
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
25% identity, 81% coverage: 38:331/361 of query aligns to 12:296/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
25% identity, 81% coverage: 38:331/361 of query aligns to 12:296/301 of 4n15A
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
27% identity, 60% coverage: 53:268/361 of query aligns to 22:235/300 of 4n8yA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
24% identity, 75% coverage: 28:297/361 of query aligns to 1:267/304 of 4x8rA
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
25% identity, 68% coverage: 53:297/361 of query aligns to 22:265/306 of 4xfeA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
22% identity, 80% coverage: 51:338/361 of query aligns to 20:303/303 of 4p3lA
Sites not aligning to the query:
>AZOBR_RS29770 FitnessBrowser__azobra:AZOBR_RS29770
MKRRQFFKGAAVVAGASTLAAPAIAQSEPTIRWRCVSSFPKNIEVLYGSAEVLAKNIAEA
TDGKFQIQVFAAGELVPALQALDAASNDTVEMAHTASYYYVGKDPSFAFGCCLPFGLNTR
QQNAWFYHGEGGKLLEEFYAGHNLKALAGGNTGSQMGGWFRKEIKNAEDLKGLKFRISGL
GGQILSKLGVVPQQVSGGDIYPALERGTIDAAEFNGPYDDEKLGLYKIAPNYYYPGWWDG
TSLQHFFINTNRWNSLPKHYQAALTSAAALANVDSVARYDVLNPAALKRVVEKGAKLRAF
PQDVLQASHKAAMELYDELSDKNPTFKKFYESYRRFQTDSNLWNQASEYAYDSAVLRLAR
R
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory