SitesBLAST
Comparing AZOBR_RS29810 FitnessBrowser__azobra:AZOBR_RS29810 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
54% identity, 98% coverage: 5:387/389 of query aligns to 14:391/392 of P33221
- EL 22:23 (= EL 13:14) binding
- E82 (= E73) binding
- R114 (= R105) binding
- K155 (= K146) binding
- SSGKGQ 160:165 (= SSGKGQ 151:156) binding
- G162 (= G153) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ T170) modified: N6-acetyllysine
- EGVV 195:198 (≠ EEFV 186:189) binding
- E203 (= E194) binding
- E267 (= E258) binding
- E279 (= E270) binding
- D286 (= D277) binding
- K355 (= K351) binding
- RR 362:363 (= RR 358:359) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
55% identity, 98% coverage: 5:387/389 of query aligns to 13:388/389 of 1kjiA
- active site: E114 (≠ D106), K154 (= K146), S159 (= S151), G161 (= G153), E264 (= E258), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R359)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R105), I152 (≠ V144), K154 (= K146), S159 (= S151), S160 (= S152), G161 (= G153), Q164 (= Q156), E192 (= E186), V195 (= V189), E200 (= E194), Q222 (= Q216), E264 (= E258), F266 (= F260), E276 (= E270)
- binding magnesium ion: E264 (= E258), E276 (= E270)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
55% identity, 98% coverage: 5:387/389 of query aligns to 13:388/389 of 1ez1A
- active site: E114 (≠ D106), K154 (= K146), S159 (= S151), G161 (= G153), E264 (= E258), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R359)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R105), I152 (≠ V144), K154 (= K146), S159 (= S151), S160 (= S152), G161 (= G153), E192 (= E186), V194 (≠ F188), V195 (= V189), F197 (= F191), E200 (= E194), Q222 (= Q216), E264 (= E258), F266 (= F260), E276 (= E270)
- binding glycinamide ribonucleotide: G20 (= G12), E21 (= E13), L22 (= L14), E81 (= E73), I82 (≠ V74), S160 (= S152), D283 (= D277), K352 (= K351), R359 (= R358), R360 (= R359)
- binding magnesium ion: E264 (= E258), E276 (= E270)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
55% identity, 98% coverage: 5:387/389 of query aligns to 13:388/389 of 1eyzA
- active site: E114 (≠ D106), K154 (= K146), S159 (= S151), G161 (= G153), E264 (= E258), E276 (= E270), D283 (= D277), T284 (= T278), R360 (= R359)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R105), I152 (≠ V144), K154 (= K146), S159 (= S151), S160 (= S152), G161 (= G153), Q164 (= Q156), E192 (= E186), V195 (= V189), F197 (= F191), E200 (= E194), E264 (= E258), F266 (= F260), E276 (= E270)
- binding magnesium ion: E264 (= E258), E276 (= E270)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
55% identity, 98% coverage: 5:387/389 of query aligns to 13:385/386 of 1kjjA
- active site: E114 (≠ D106), K154 (= K146), S159 (= S151), G161 (= G153), E261 (= E258), E273 (= E270), D280 (= D277), T281 (= T278), R357 (= R359)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R105), I152 (≠ V144), K154 (= K146), S159 (= S151), S160 (= S152), G161 (= G153), Q164 (= Q156), E189 (= E186), V192 (= V189), E197 (= E194), Q219 (= Q216), E261 (= E258), F263 (= F260), E273 (= E270)
- binding magnesium ion: E261 (= E258), E273 (= E270)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
55% identity, 98% coverage: 5:387/389 of query aligns to 13:385/386 of 1kj8A
- active site: E114 (≠ D106), K154 (= K146), S159 (= S151), G161 (= G153), E261 (= E258), E273 (= E270), D280 (= D277), T281 (= T278), R357 (= R359)
- binding adenosine-5'-triphosphate: R113 (= R105), I152 (≠ V144), K154 (= K146), S159 (= S151), S160 (= S152), G161 (= G153), Q164 (= Q156), E189 (= E186), V192 (= V189), F194 (= F191), E197 (= E194), Q219 (= Q216), G222 (= G219), E261 (= E258), F263 (= F260), E273 (= E270)
- binding glycinamide ribonucleotide: G20 (= G12), E21 (= E13), L22 (= L14), E81 (= E73), I82 (≠ V74), S160 (= S152), D280 (= D277), K349 (= K351), R356 (= R358)
- binding magnesium ion: E261 (= E258), E273 (= E270)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
54% identity, 98% coverage: 5:387/389 of query aligns to 13:387/388 of 1kjqA
- active site: E114 (≠ D106), K154 (= K146), E263 (= E258), E275 (= E270), D282 (= D277), T283 (= T278), R359 (= R359)
- binding adenosine-5'-diphosphate: R113 (= R105), I152 (≠ V144), K154 (= K146), E191 (= E186), V193 (≠ F188), V194 (= V189), F196 (= F191), E199 (= E194), Q221 (= Q216), F265 (= F260), E275 (= E270)
- binding magnesium ion: E263 (= E258), E275 (= E270)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
46% identity, 98% coverage: 5:387/389 of query aligns to 18:411/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
45% identity, 98% coverage: 5:387/389 of query aligns to 20:400/409 of 2dwcB
- active site: E265 (= E258), E277 (= E270), D284 (= D277), T285 (= T278), R372 (= R359)
- binding adenosine-5'-diphosphate: R120 (= R105), H159 (≠ V144), K161 (= K146), H190 (≠ F188), I191 (≠ V189), F193 (= F191), E196 (= E194), F267 (= F260), E277 (= E270)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
26% identity, 94% coverage: 20:386/389 of query aligns to 18:357/360 of 3ax6A
- active site: E231 (= E258), E244 (= E270), N251 (≠ D277), S252 (≠ T278), K330 (≠ R359)
- binding adenosine-5'-diphosphate: K101 (≠ R105), V136 (= V144), K138 (= K146), E164 (= E186), F166 (= F188), V167 (= V189), E172 (= E194), F233 (= F260), N243 (≠ S269)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 96% coverage: 13:386/389 of query aligns to 18:371/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G153), E255 (= E258), E268 (= E270), N275 (≠ D277), S276 (≠ T278), K348 (≠ R359)
- binding adenosine-5'-triphosphate: E76 (= E73), F77 (≠ V74), R107 (= R107), K147 (= K146), Y153 (vs. gap), D154 (≠ S152), G155 (= G153), Q158 (= Q156), W184 (≠ F188), V185 (= V189), F187 (= F191), E190 (= E194), E255 (= E258), F257 (= F260), N267 (≠ S269), E268 (= E270), R272 (= R274), H274 (= H276), N275 (≠ D277), K340 (= K351), R347 (= R358), K348 (≠ R359)
- binding calcium ion: E255 (= E258), E268 (= E270)
- binding phosphate ion: Q47 (= Q42), A49 (= A44)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 96% coverage: 13:386/389 of query aligns to 19:372/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R107), K148 (= K146), Y154 (vs. gap), D155 (≠ S152), G156 (= G153), Q159 (= Q156), E183 (= E186), W185 (≠ F188), V186 (= V189), F188 (= F191), E191 (= E194), H214 (≠ E217), N217 (≠ D220), E256 (= E258), F258 (= F260), E269 (= E270)
- binding carbonate ion: R273 (= R274), H275 (= H276), N276 (≠ D277)
- binding magnesium ion: T105 (≠ N104), E111 (= E110), E256 (= E258), E269 (= E270), L270 (= L271)
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 96% coverage: 13:386/389 of query aligns to 17:370/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R107), K146 (= K146), Y152 (vs. gap), G154 (= G153), Q157 (= Q156), W183 (≠ F188), V184 (= V189), E189 (= E194), N215 (≠ D220), F256 (= F260), N266 (≠ S269), E267 (= E270)
- binding carbonate ion: R271 (= R274), H273 (= H276), N274 (≠ D277)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 96% coverage: 13:386/389 of query aligns to 18:371/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R107), K147 (= K146), Q158 (= Q156), W184 (≠ F188), V185 (= V189), F187 (= F191), E190 (= E194), N216 (≠ D220), F257 (= F260), N267 (≠ S269), E268 (= E270)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E13), L19 (= L14), E76 (= E73), Y153 (vs. gap), R272 (= R274), K340 (= K351), R347 (= R358)
Sites not aligning to the query:
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 96% coverage: 13:386/389 of query aligns to 18:371/377 of 3q2oB
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
31% identity, 80% coverage: 18:330/389 of query aligns to 14:314/360 of 3aw8A
- active site: E240 (= E258), E252 (= E270), N259 (≠ D277), S260 (≠ T278)
- binding adenosine monophosphate: L135 (≠ V144), K137 (= K146), Q142 (= Q156), F168 (= F188), V169 (= V189), E174 (= E194), H197 (≠ Q216), F242 (= F260), E252 (= E270)
Sites not aligning to the query:
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
28% identity, 76% coverage: 5:301/389 of query aligns to 2:290/366 of 4ma0A
- active site: Y144 (≠ S151), G146 (= G153), E247 (= E258), E259 (= E270), N266 (≠ D277), S267 (≠ T278)
- binding adenosine monophosphate: I136 (≠ V144), K138 (= K146), E175 (= E186), A176 (≠ E187), F177 (= F188), V178 (= V189), E183 (= E194), H206 (≠ Q216), F249 (= F260), E259 (= E270)
Sites not aligning to the query:
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
28% identity, 76% coverage: 5:301/389 of query aligns to 2:290/373 of 4mamA
- active site: Y144 (≠ S151), G146 (= G153), E247 (= E258), E259 (= E270), N266 (≠ D277), S267 (≠ T278)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R107), I136 (≠ V144), K138 (= K146), Y144 (≠ S151), G146 (= G153), Q149 (= Q156), E175 (= E186), F177 (= F188), V178 (= V189), F180 (= F191), E183 (= E194), H206 (≠ Q216), F249 (= F260), E259 (= E270)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
28% identity, 76% coverage: 5:301/389 of query aligns to 2:290/365 of 5jqwA
- active site: Y144 (≠ S151), G146 (= G153), E247 (= E258), E259 (= E270), N266 (≠ D277), S267 (≠ T278)
- binding adenosine-5'-diphosphate: R98 (= R107), K138 (= K146), G143 (≠ S150), Y144 (≠ S151), D145 (≠ S152), G146 (= G153), V178 (= V189), E183 (= E194), H206 (≠ Q216), F249 (= F260), E259 (= E270)
Sites not aligning to the query:
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
27% identity, 88% coverage: 18:361/389 of query aligns to 19:355/381 of 3k5iA
- active site: E254 (= E258), E267 (= E270), N274 (≠ D277), S275 (≠ T278), K353 (≠ R359)
- binding adenosine-5'-diphosphate: K104 (≠ R105), K146 (= K146), Y152 (≠ S151), D153 (≠ S152), G154 (= G153), W183 (≠ F188), A184 (≠ V189), F186 (= F191), E189 (= E194), Q211 (= Q216), S214 (≠ G219), E267 (= E270)
- binding 5-aminoimidazole ribonucleotide: E73 (= E73), I74 (≠ V74), Y152 (≠ S151), D153 (≠ S152), R155 (≠ K154), R271 (= R274), K345 (= K351), R352 (= R358)
- binding magnesium ion: E254 (= E258), E267 (= E270)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS29810 FitnessBrowser__azobra:AZOBR_RS29810
MFTAKILLLGSGELGKEFVIAAKRLGCEVIACDSYANAPAMQVADAAEVFSMLDPDALRA
AIAKHTPDFIVPEVEAIRTEVLHEFEDAGLTVVPSARAATMTMNRDRIREVAAVELGLRT
SKYRYAESLEEVIAGTEHTGLPCVIKPVMSSSGKGQSTVRTAEELEAAWTYAVANMRGDR
RKVIVEEFVPFEYEITLLTVRTREGILFCEPIGHRQERGDYQESWQPVPMPTALLDDAKD
MAAKVVDNLGGYGIFGVEFFVTKDEVVFSELSPRPHDTGMVTLLSQNLSEFDLHARAILG
LPIPAIHVRGPAASAVILADREAERFAIEGLADAMRVGSAEHDVDVRLFGKPTTRKNRRM
GVALAAGTDTDDARERALKAASAISIRYE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory