SitesBLAST
Comparing AZOBR_RS29845 FitnessBrowser__azobra:AZOBR_RS29845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
28% identity, 99% coverage: 4:342/342 of query aligns to 4:322/322 of 3q2kK
- active site: K95 (= K95), H183 (= H183)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ M12), K95 (= K95), T155 (≠ W155), R156 (= R156), Y160 (= Y160), N179 (≠ T179), Q180 (= Q180), H183 (= H183), N239 (≠ Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G11 (= G11), R12 (≠ M12), I13 (≠ A13), D35 (≠ S35), T36 (≠ P36), T72 (= T72), P73 (= P73), S74 (≠ P74), L76 (≠ T76), H77 (= H77), E94 (= E94), K95 (= K95), Q123 (= Q123), W166 (≠ G165), R167 (= R166), H183 (= H183)
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
27% identity, 99% coverage: 4:342/342 of query aligns to 9:347/347 of 3q2kC
- active site: K100 (= K95), H188 (= H183)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ M12), K100 (= K95), W159 (= W154), T160 (≠ W155), R161 (= R156), Y165 (= Y160), N184 (≠ T179), Q185 (= Q180), H188 (= H183), Q243 (≠ G239), N244 (≠ Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G11), R17 (≠ M12), I18 (≠ A13), D40 (≠ S35), T41 (≠ P36), A76 (≠ L71), T77 (= T72), S79 (≠ P74), H82 (= H77), Q85 (≠ L80), E99 (= E94), K100 (= K95), Q128 (= Q123), W171 (≠ G165), R172 (= R166)
3e18A Crystal structure of NAD-binding protein from listeria innocua
26% identity, 97% coverage: 2:334/342 of query aligns to 3:343/348 of 3e18A
- active site: K94 (= K95), H178 (= H183)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), G13 (≠ M12), M14 (≠ A13), F34 (= F34), D35 (≠ S35), I36 (≠ P36), K40 (≠ R40), A70 (≠ L71), T71 (= T72), P72 (= P73), N73 (≠ P74), H76 (= H77), E93 (= E94), K94 (= K95), N122 (≠ Q123), W161 (vs. gap), R162 (= R166), H178 (= H183)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
32% identity, 85% coverage: 29:318/342 of query aligns to 26:307/332 of 2glxA
- active site: K93 (= K95), H179 (= H183)
- binding acetate ion: K93 (= K95), H179 (= H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S32 (= S35), T33 (≠ P36), R37 (= R40), S69 (≠ L71), T70 (= T72), N72 (≠ P74), H75 (= H77), E92 (= E94), K93 (= K95), H121 (≠ Q123), W161 (≠ G165), R162 (= R166), Y282 (≠ H293)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 2:331/336 of 5a06A
- active site: K101 (= K95), Y186 (≠ H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (= L10), G12 (= G11), Y13 (≠ M12), Y14 (≠ A13), S36 (= S35), G37 (≠ P36), T38 (≠ S37), K41 (≠ R40), Y59 (vs. gap), I77 (≠ L71), T78 (= T72), P79 (= P73), N80 (≠ P74), L82 (≠ T76), H83 (= H77), E100 (= E94), K101 (= K95), R129 (≠ Q123), W168 (= W155), R169 (= R156), Y186 (≠ H183), Y264 (≠ V270)
- binding sorbitol: R2 (= R3), D72 (≠ S66), H96 (= H90), K101 (= K95), R122 (≠ L116), R122 (≠ L116), L124 (= L118), F160 (vs. gap), R169 (= R156), D182 (≠ T179), Y186 (≠ H183), K287 (≠ N290), H296 (≠ D299), E299 (≠ D302), E306 (≠ Q309), G310 (≠ S313), G311 (= G314)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 1:330/335 of 5a05A
- active site: K100 (= K95), Y185 (≠ H183)
- binding beta-D-glucopyranose: K100 (= K95), F159 (vs. gap), D181 (≠ T179), Y185 (≠ H183)
- binding alpha-D-glucopyranose: P259 (≠ S266), S262 (≠ T269)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G9), L10 (= L10), G11 (= G11), Y12 (≠ M12), Y13 (≠ A13), S35 (= S35), G36 (≠ P36), T37 (≠ S37), K40 (≠ R40), Y58 (vs. gap), I76 (≠ L71), T77 (= T72), P78 (= P73), N79 (≠ P74), L81 (≠ T76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ Q123), W167 (= W155), R168 (= R156), Y185 (≠ H183), Y263 (≠ V270)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 1:330/335 of 5a04A
- active site: K100 (= K95), Y185 (≠ H183)
- binding beta-D-glucopyranose: K100 (= K95), F159 (vs. gap), R168 (= R156), D181 (≠ T179), Y185 (≠ H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (= L10), G11 (= G11), Y12 (≠ M12), Y13 (≠ A13), S35 (= S35), G36 (≠ P36), T37 (≠ S37), K40 (≠ R40), Y58 (vs. gap), I76 (≠ L71), T77 (= T72), P78 (= P73), N79 (≠ P74), L81 (≠ T76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ Q123), W167 (= W155), R168 (= R156), Y185 (≠ H183), Y263 (≠ V270)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 1:330/335 of 5a03E
- active site: K100 (= K95), Y185 (≠ H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G9), L10 (= L10), G11 (= G11), Y12 (≠ M12), Y13 (≠ A13), S35 (= S35), G36 (≠ P36), T37 (≠ S37), K40 (≠ R40), Y58 (vs. gap), I76 (≠ L71), T77 (= T72), P78 (= P73), N79 (≠ P74), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ Q123), W167 (= W155), R168 (= R156), Y185 (≠ H183), Y263 (≠ V270)
- binding beta-D-xylopyranose: K100 (= K95), F159 (vs. gap), R168 (= R156), D181 (≠ T179), Y185 (≠ H183), E205 (≠ A202), T207 (= T204), R209 (vs. gap)
- binding alpha-D-xylopyranose: H134 (≠ A129), M268 (≠ T275), R279 (vs. gap), E280 (≠ D284)
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 2:331/336 of 5a03C
- active site: K101 (= K95), Y186 (≠ H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), L11 (= L10), G12 (= G11), Y13 (≠ M12), Y14 (≠ A13), S36 (= S35), G37 (≠ P36), T38 (≠ S37), K41 (≠ R40), Y59 (vs. gap), I77 (≠ L71), T78 (= T72), P79 (= P73), N80 (≠ P74), L82 (≠ T76), H83 (= H77), E100 (= E94), K101 (= K95), R129 (≠ Q123), W168 (= W155), R169 (= R156), Y186 (≠ H183), Y264 (≠ V270)
- binding beta-D-xylopyranose: K101 (= K95), F160 (vs. gap), R169 (= R156), D182 (≠ T179), Y186 (≠ H183)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
27% identity, 97% coverage: 3:334/342 of query aligns to 1:330/335 of 5a02A
- active site: K100 (= K95), Y185 (≠ H183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (= L10), G11 (= G11), Y12 (≠ M12), Y13 (≠ A13), S35 (= S35), G36 (≠ P36), T37 (≠ S37), K40 (≠ R40), Y58 (vs. gap), I76 (≠ L71), T77 (= T72), P78 (= P73), L81 (≠ T76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ Q123), W167 (= W155), R168 (= R156), Y185 (≠ H183), Y263 (≠ V270)
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
27% identity, 99% coverage: 4:342/342 of query aligns to 13:344/345 of 3q2iA
- active site: K104 (= K95), H192 (= H183)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K95), N133 (≠ H124), T164 (≠ W155), R165 (= R156), Y169 (= Y160), N188 (≠ T179), Q189 (= Q180), H192 (= H183), K247 (≠ G239), N248 (≠ Y240)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ L10), G20 (= G11), R21 (≠ M12), I22 (≠ A13), D44 (≠ S35), I45 (≠ P36), T81 (= T72), P82 (= P73), S83 (≠ P74), H86 (= H77), E103 (= E94), K104 (= K95), Q132 (= Q123), W175 (vs. gap), R176 (= R166), H192 (= H183)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
31% identity, 85% coverage: 29:318/342 of query aligns to 27:308/333 of Q2I8V6
- S33 (= S35) mutation to D: No activity.
- ST 33:34 (≠ SP 35:36) binding
- R38 (= R40) binding
- TTNELH 71:76 (≠ TPPDTH 72:77) binding
- EK 93:94 (= EK 94:95) binding
- K94 (= K95) mutation to G: Less than 1% remaining activity.
- N120 (≠ M121) binding
- WR 162:163 (≠ GR 165:166) binding
- D176 (≠ T179) mutation to A: Less than 1% remaining activity.
- H180 (= H183) mutation to A: Less than 2% remaining activity.
- G206 (≠ R208) mutation to I: No effect.
- Y283 (≠ H293) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
33% identity, 85% coverage: 29:318/342 of query aligns to 27:308/333 of 4koaA
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
30% identity, 69% coverage: 4:240/342 of query aligns to 5:228/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ L122), Q173 (= Q180), H176 (= H183)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), G12 (= G11), R13 (≠ M12), A14 (= A13), D35 (≠ S35), P36 (= P36), R37 (≠ S37), A71 (≠ L71), S72 (≠ T72), P73 (= P73), F76 (≠ T76), Q80 (≠ L80), E94 (= E94), K95 (= K95), P96 (= P96), R161 (≠ M168), P163 (≠ A170), E164 (≠ R171)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
27% identity, 76% coverage: 2:260/342 of query aligns to 3:261/325 of 1zh8A
- active site: K98 (= K95), H187 (= H183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), C11 (≠ L10), G12 (= G11), I13 (≠ M12), A14 (= A13), S37 (= S35), R38 (≠ P36), T39 (≠ S37), H42 (≠ R40), T74 (≠ L71), L75 (≠ T72), P76 (= P73), L79 (≠ T76), E97 (= E94), K98 (= K95), N126 (≠ Q123), Y165 (= Y161), W170 (≠ R166), R171 (≠ G167), H187 (= H183)
Sites not aligning to the query:
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
25% identity, 78% coverage: 4:271/342 of query aligns to 3:267/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), Y11 (≠ M12), F12 (≠ A13), Y32 (≠ F34), D33 (≠ S35), A67 (≠ L71), T68 (= T72), P69 (= P73), N70 (≠ P74), H73 (= H77), E90 (= E94), K91 (= K95), I119 (≠ Q123), W160 (≠ G165)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
29% identity, 63% coverage: 45:259/342 of query aligns to 52:276/372 of 6a3iA
- binding Levoglucosan: K103 (= K95), Y132 (≠ H124), Y160 (≠ V151), Q162 (≠ R153), R175 (= R166), D188 (≠ T179), H192 (= H183)
- binding 1,4-dihydronicotinamide adenine dinucleotide: P81 (= P73), N82 (≠ P74), L84 (≠ T76), H85 (= H77), E102 (= E94), K103 (= K95), W174 (≠ G165), R175 (= R166)
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
29% identity, 63% coverage: 45:259/342 of query aligns to 51:280/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: T79 (= T72), P80 (= P73), N81 (≠ P74), H84 (= H77), E101 (= E94), K102 (= K95), W173 (≠ G165), R174 (= R166)
- binding alpha-L-sorbopyranose: K102 (= K95), Y131 (≠ H124), Y159 (≠ V151), Q161 (≠ R153), W163 (= W155), R174 (= R166), D187 (≠ T179)
Sites not aligning to the query:
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 43% coverage: 1:146/342 of query aligns to 1:149/336 of 3ec7A
- active site: K97 (= K95)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), M12 (= M12), I13 (≠ A13), D35 (≠ S35), I36 (≠ P36), R40 (= R40), T73 (≠ L71), A74 (≠ T72), S75 (≠ P73), N76 (≠ P74), H79 (= H77), E96 (= E94), K97 (= K95), M126 (= M121)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
24% identity, 97% coverage: 3:334/342 of query aligns to 32:368/383 of 1h6dA
- active site: K131 (= K95), Y219 (≠ H183)
- binding glycerol: K131 (= K95), R202 (= R166), D215 (≠ T179), Y219 (≠ H183)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G9), L41 (= L10), G42 (= G11), K43 (≠ M12), Y44 (≠ A13), S66 (= S35), G67 (≠ P36), K71 (≠ R40), Y89 (≠ V53), I107 (≠ L71), L108 (≠ T72), P109 (= P73), N110 (≠ P74), H113 (= H77), E130 (= E94), K131 (= K95), R159 (≠ Q123), A198 (= A162), W201 (≠ G165), R202 (= R166), Y219 (≠ H183), Y298 (≠ Q263)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS29845 FitnessBrowser__azobra:AZOBR_RS29845
MRRRVGVIGLGMAATPHAQSLLDLADRVEVAGCFSPSAERRAAFAARFGLPAVDRAEAIL
DDPTVSAVLLLTPPDTHADLVARCAAAGKHVLLEKPLDATPAGCRAVVESMERAGLTLGV
MLQHRFRAAAERLAELLRTGTLGRPLSASVVVRWWRDDAYYAQPGRGMKARDGGGVLLTQ
AIHTLDLYVSLLGLPREVAAFANTSGLRPIDTEDVVCAALRYDGGLLATVDATTAAYPGY
PERIEIAGTAGSALLTGDRLEVQLRSGGTVQAGETAGTLGGGADPMAFSNAHHRAVLADF
LDALDDGTQPRVSGREALKVHRLIETILKSSESGAVTAVPKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory