Comparing AZOBR_RS29980 FitnessBrowser__azobra:AZOBR_RS29980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3abiA Crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii (see paper)
30% identity, 65% coverage: 4:246/375 of query aligns to 4:238/349 of 3abiA
Sites not aligning to the query:
Q9UDR5 Alpha-aminoadipic semialdehyde synthase, mitochondrial; LKR/SDH; EC 1.5.1.8; EC 1.5.1.9 from Homo sapiens (Human)
22% identity, 89% coverage: 2:333/375 of query aligns to 481:810/926 of Q9UDR5
5l78A Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in NAD+ bound form)
23% identity, 50% coverage: 2:190/375 of query aligns to 1:196/436 of 5l78A
Sites not aligning to the query:
5o1oA Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain with proline bound.
23% identity, 50% coverage: 2:190/375 of query aligns to 1:196/439 of 5o1oA
Sites not aligning to the query:
5o1nA Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain with n-[(2s)-2-pyrrolidinylmethyl]- trifluoromethanesulfonamide bound
23% identity, 50% coverage: 2:190/375 of query aligns to 1:196/442 of 5o1nA
Sites not aligning to the query:
1e5qA Ternary complex of saccharopine reductase from magnaporthe grisea, NADPH and saccharopine (see paper)
25% identity, 46% coverage: 2:172/375 of query aligns to 3:179/449 of 1e5qA
Sites not aligning to the query:
Q9P4R4 Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]; Saccharopine reductase; EC 1.5.1.10 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see paper)
25% identity, 46% coverage: 2:172/375 of query aligns to 4:180/450 of Q9P4R4
Sites not aligning to the query:
>AZOBR_RS29980 FitnessBrowser__azobra:AZOBR_RS29980
MRDILLMGGGKIGETIGDFLKATGDYRVTVADRSAEALERLPTHPRMETRVVDAADPAEL
AEAMRGKFAVLSALPYHLTVGVAEAARDAGTHYLDLTEDVASTRRVKELADGAPCAFIPQ
CGLAPGFISIVANDVASRFDTLDTVRMRVGALPKYPSNALNYNLTWSTEGVINEYLEPCE
AIVEGRLVSVPPLEEREEFSLDGVLYEAFNTSGGLGTLCETLAGKVRTLNYRSVRYPGHR
DLMKALLHDLRLGSRRELLKDILEHSIPATLQDVVLIFVTVTGTKRGRLLQETYANKIYG
REIGGTFYNGIQITTASGMCAVLDLLADGTLPQRGFVKQEEVRYADFIANRFGRNYAMTD
AAPQQGAQQGVGRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory