SitesBLAST
Comparing AZOBR_RS30030 FitnessBrowser__azobra:AZOBR_RS30030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
31% identity, 92% coverage: 52:723/729 of query aligns to 17:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ K73), G39 (= G74), Q40 (= Q75), H41 (≠ G76), V42 (≠ I77), A45 (≠ G80), G79 (= G119), G80 (= G120), S81 (= S121), S83 (≠ A123), V84 (= V124), G374 (≠ S402), F375 (= F403), L379 (≠ A407), L499 (≠ W524), R500 (= R525), V624 (= V629), D625 (≠ N630), Q632 (= Q637), T687 (= T692), G688 (= G693), L689 (≠ V694), G690 (= G695), E691 (= E696)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
27% identity, 41% coverage: 277:578/729 of query aligns to 119:407/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 54% coverage: 210:601/729 of query aligns to 10:438/761 of 1rm6A
Sites not aligning to the query:
- active site: 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 473, 474, 475, 476, 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 54% coverage: 210:601/729 of query aligns to 18:446/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
34% identity, 17% coverage: 598:723/729 of query aligns to 183:316/330 of 3hrdB
- active site: E289 (= E696), P290 (= P697)
- binding pterin cytosine dinucleotide: I215 (≠ V629), N216 (= N630), M219 (≠ I633), V220 (= V634), Q223 (= Q637), K285 (≠ T692), G286 (= G693), V287 (= V694), G288 (= G695), E289 (= E696)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
34% identity, 17% coverage: 598:723/729 of query aligns to 183:316/330 of Q0QLF1
- 211:223 (vs. 625:637, 38% identical) binding
- AKGVGE 284:289 (≠ -TGVGE 692:696) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
7dqxD Crystal structure of xanthine dehydrogenase family protein
24% identity, 49% coverage: 202:559/729 of query aligns to 6:397/770 of 7dqxD
Sites not aligning to the query:
- binding pterin cytosine dinucleotide: 491, 492, 493, 494, 498, 530, 531, 532, 533, 534, 535, 536, 658, 659, 662, 725, 726, 727, 728
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 59% coverage: 200:626/729 of query aligns to 16:471/732 of P77489
- GF 241:242 (≠ SF 402:403) binding
- R440 (≠ V600) mutation R->H,K: Decrease in catalytic efficiency.
- IGT 468:470 (≠ VDC 623:625) binding
Sites not aligning to the query:
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
23% identity, 49% coverage: 197:556/729 of query aligns to 3:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
27% identity, 38% coverage: 188:465/729 of query aligns to 527:831/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 49% coverage: 197:556/729 of query aligns to 2:381/420 of 3hrdE
- active site: Q207 (= Q372), L242 (≠ A411), R318 (≠ K487), H322 (≠ D491), R350 (= R525)
- binding calcium ion: T206 (≠ S371), N208 (≠ F373), D212 (≠ E377), K241 (≠ R406), L242 (≠ A411), D243 (= D412)
- binding pterin cytosine dinucleotide: G237 (≠ S402), F238 (= F403), R350 (= R525)
- binding selenium atom: F238 (= F403), A348 (≠ W523), F349 (≠ W524), R350 (= R525)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 49% coverage: 197:556/729 of query aligns to 2:381/420 of 3hrdA
- active site: Q207 (= Q372), L242 (≠ A411), R318 (≠ K487), H322 (≠ D491), R350 (= R525)
- binding pterin cytosine dinucleotide: G236 (= G401), G237 (≠ S402), F238 (= F403), R350 (= R525)
- binding magnesium ion: T206 (≠ S371), N208 (≠ F373), D212 (≠ E377), K241 (≠ R406), L242 (≠ A411), D243 (= D412), T305 (≠ S474), Y308 (≠ I477), A309 (≠ G478), S346 (≠ T520)
- binding nicotinic acid: A314 (≠ G483), R318 (≠ K487), F352 (≠ V527)
- binding selenium atom: F238 (= F403), G239 (= G404), A348 (≠ W523), F349 (≠ W524), R350 (= R525)
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
27% identity, 38% coverage: 188:465/729 of query aligns to 525:829/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
27% identity, 38% coverage: 188:465/729 of query aligns to 525:829/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
27% identity, 38% coverage: 188:465/729 of query aligns to 527:831/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 59% coverage: 200:626/729 of query aligns to 16:471/731 of 5g5gC
- active site: Q211 (= Q372), L246 (≠ A407), P316 (≠ D491), Q322 (≠ S498), R350 (= R525)
- binding pterin cytosine dinucleotide: G240 (= G401), G241 (≠ S402), F242 (= F403), R350 (= R525), I468 (≠ V623), G469 (≠ D624), T470 (≠ C625)
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 38% coverage: 188:465/729 of query aligns to 554:858/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
23% identity, 49% coverage: 202:561/729 of query aligns to 545:912/1290 of 4uhxA
Sites not aligning to the query:
- active site: 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 237, 310, 311, 319, 320, 323, 324, 326, 329, 332, 333, 377, 404
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
31% identity, 18% coverage: 602:729/729 of query aligns to 567:701/701 of 4zohA
Sites not aligning to the query:
- active site: 186, 219, 298, 300, 304, 332
- binding pterin cytosine dinucleotide: 213, 214, 215, 332, 442, 443, 444, 446, 482, 484, 486, 487
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
26% identity, 32% coverage: 324:557/729 of query aligns to 342:565/907 of 4usaA
- active site: I390 (≠ Q372), F425 (≠ A407), R501 (≠ F481), F505 (≠ M485), R533 (= R525)
- binding bicarbonate ion: R460 (= R446), A531 (vs. gap), F532 (≠ W524), Y535 (≠ V527), Q539 (≠ H531)
- binding hydrocinnamic acid: F425 (≠ A407), F494 (≠ I477), L497 (vs. gap), Y535 (≠ V527)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ S402), F421 (= F403), G422 (= G404), R533 (= R525)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 255, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>AZOBR_RS30030 FitnessBrowser__azobra:AZOBR_RS30030
IKQAAADVAAPSRRGFLKGAGGALVLGAMLPRTGFASEAAAPKVVGPADPRPQAFIRIAA
DDTVTVLVKHLDKGQGIMTGLTTIVAEELDADWAQMRGAFAPADGALYANHFFGIQGTGG
STAVANSWDELRMAGAAARAMLVATAAARWSVPASPVTVEQGVVRHAASNRSARFGELAE
DAAKLPVPQNVALKDAKDYKLIGNPSLHRLDHVSKTDGTAIFAMDIRRPGQVTAVLARSP
RFGGTVKSVDAAAAKQVPGVLEVLTLPMGVAVVARNTWAAMKGREALTVEWDDAKAEMRG
TEEMLADYRKLADQPGNVATDTGDAAKALAGAAKVVEAEFVFPYLAHAPMEPLNATVELT
PDGGCTIWAGSQFQGVEQKVAAGILGCKPEQVVINTVWAGGSFGRRATPDADYIAEAVTI
AKAYGGKAPVHLVWTREDDIRGGRYRPLFLHKVKAGLDASGTLVAWRQSIVGQSFMIGTL
FEGFMVKNGVDATSVEGSSDMAYTVPNLHVDLHSPPSPVTTLWWRSVGHTHTAYAKEVMI
DELAAAAGKDPVAFRLEMLKDHPRLQGVLKLAAEKAGWGQPLPKGKGRGIAVHESFSSFV
AHVAEVSVDEQGRVTIDRVVCAVDCGQVVNPNIVEAQVSGGTGWAIGHALRDEITLTGGL
VDQSNFDAYQPLRNSEMPPIEVHILPSTARPTGVGEPGVPTAAPAVANAVFAATGKRLHH
LPFTRSGMV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory