SitesBLAST
Comparing AZOBR_RS30410 FitnessBrowser__azobra:AZOBR_RS30410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
48% identity, 90% coverage: 7:340/371 of query aligns to 11:341/378 of P69874
- C26 (≠ S27) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y28) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F46) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C55) mutation to T: Loss of ATPase activity and transport.
- L60 (= L61) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I77) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V136) mutation to M: Loss of ATPase activity and transport.
- D172 (= D173) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ V274) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ Q295) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
1g291 Malk (see paper)
57% identity, 63% coverage: 18:251/371 of query aligns to 3:242/372 of 1g291
- binding magnesium ion: D69 (≠ G84), E71 (vs. gap), K72 (vs. gap), K79 (≠ H88), D80 (≠ K89)
- binding pyrophosphate 2-: S38 (= S53), G39 (= G54), C40 (= C55), G41 (= G56), K42 (= K57), T43 (= T58), T44 (= T59)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
56% identity, 63% coverage: 19:251/371 of query aligns to 7:245/375 of 2d62A
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
55% identity, 63% coverage: 19:251/371 of query aligns to 4:237/393 of P9WQI3
- H193 (= H207) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hprD Lpqy-sugabc in state 4 (see paper)
55% identity, 62% coverage: 21:251/371 of query aligns to 5:236/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y28), S38 (= S53), C40 (= C55), G41 (= G56), K42 (= K57), S43 (≠ T58), T44 (= T59), Q82 (= Q97), R129 (= R144), Q133 (= Q148), S135 (= S150), G136 (= G151), G137 (= G152), Q159 (≠ E174), H192 (= H207)
- binding magnesium ion: S43 (≠ T58), Q82 (= Q97)
8hprC Lpqy-sugabc in state 4 (see paper)
55% identity, 62% coverage: 21:251/371 of query aligns to 5:236/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y28), S38 (= S53), G39 (= G54), G41 (= G56), K42 (= K57), S43 (≠ T58), Q82 (= Q97), Q133 (= Q148), G136 (= G151), G137 (= G152), Q138 (= Q153), H192 (= H207)
- binding magnesium ion: S43 (≠ T58), Q82 (= Q97)
8hplC Lpqy-sugabc in state 1 (see paper)
55% identity, 62% coverage: 21:251/371 of query aligns to 5:234/384 of 8hplC
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
46% identity, 85% coverage: 18:333/371 of query aligns to 2:319/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
46% identity, 85% coverage: 18:333/371 of query aligns to 3:320/371 of P68187
- A85 (= A100) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P121) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V129) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A132) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D134) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ K139) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G152) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D173) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ L243) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ V254) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (vs. gap) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (= G285) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ K289) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (≠ M291) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G315) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (= E321) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
Sites not aligning to the query:
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 85% coverage: 18:333/371 of query aligns to 2:319/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y28), S37 (= S53), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (≠ T58), T43 (= T59), Q81 (= Q97), R128 (= R144), A132 (≠ Q148), S134 (= S150), G136 (= G152), Q137 (= Q153), E158 (= E174), H191 (= H207)
- binding magnesium ion: S42 (≠ T58), Q81 (= Q97)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 85% coverage: 18:333/371 of query aligns to 2:319/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y28), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (≠ T58), T43 (= T59), R128 (= R144), S134 (= S150), Q137 (= Q153)
- binding beryllium trifluoride ion: S37 (= S53), G38 (= G54), K41 (= K57), Q81 (= Q97), S134 (= S150), G136 (= G152), H191 (= H207)
- binding magnesium ion: S42 (≠ T58), Q81 (= Q97)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 85% coverage: 18:333/371 of query aligns to 2:319/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y28), V17 (= V33), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (≠ T58), T43 (= T59), R128 (= R144), A132 (≠ Q148), S134 (= S150), Q137 (= Q153)
- binding tetrafluoroaluminate ion: S37 (= S53), G38 (= G54), K41 (= K57), Q81 (= Q97), S134 (= S150), G135 (= G151), G136 (= G152), E158 (= E174), H191 (= H207)
- binding magnesium ion: S42 (≠ T58), Q81 (= Q97)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 85% coverage: 18:333/371 of query aligns to 2:319/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y28), V17 (= V33), G38 (= G54), C39 (= C55), G40 (= G56), K41 (= K57), S42 (≠ T58), T43 (= T59), R128 (= R144), A132 (≠ Q148), S134 (= S150), Q137 (= Q153)
- binding magnesium ion: S42 (≠ T58), Q81 (= Q97)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 85% coverage: 19:333/371 of query aligns to 1:317/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y28), S35 (= S53), G36 (= G54), C37 (= C55), G38 (= G56), K39 (= K57), S40 (≠ T58), T41 (= T59), R126 (= R144), A130 (≠ Q148), S132 (= S150), G134 (= G152), Q135 (= Q153)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
46% identity, 85% coverage: 18:333/371 of query aligns to 3:318/369 of P19566
- L86 (= L101) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P175) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D180) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (= E321) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
44% identity, 89% coverage: 14:343/371 of query aligns to 2:321/353 of 1vciA
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 81% coverage: 33:333/371 of query aligns to 10:289/344 of 2awnC
3d31A Modbc from methanosarcina acetivorans (see paper)
41% identity, 81% coverage: 34:334/371 of query aligns to 16:312/348 of 3d31A
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
42% identity, 61% coverage: 34:259/371 of query aligns to 21:251/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
42% identity, 61% coverage: 34:259/371 of query aligns to 21:251/353 of 1oxvA
Sites not aligning to the query:
Query Sequence
>AZOBR_RS30410 FitnessBrowser__azobra:AZOBR_RS30410
MNHQFSPTSLAAGMESVGVRIDGVDLSYGSHRVLKDIHLDIKPGEFFAFLGPSGCGKTTL
LRLIAGFNTAQRGAVTIGGRDISGLPAHKRDVGMVFQSYALWPHMTVRRNVAFGLEERRV
PRAEIERRVDAALDLVGLKHLADRRPSQLSGGQQQRVALARTIVIEPKVLLLDEPLSNLD
AKLRVQMRQELLSLQRKLGLTTIFVTHDQEEANTICDRIAVMEDGIVQQVGTPQELYDHP
ANLFVAGFLGTANVLEGQVRAVDGGTAFVMGGGVPIPLPHGVEPGAAGKLMFRPQNLFIR
QDGGPPRAGHVRLMGVVRHREFLGASIRYAVDIGGQQVQVDAPHQAGDALLPTDTPITLD
LAADKARFLRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory