Comparing AZOBR_RS30425 FitnessBrowser__azobra:AZOBR_RS30425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
34% identity, 93% coverage: 8:365/385 of query aligns to 6:358/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 98% coverage: 10:385/385 of query aligns to 13:383/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
25% identity, 98% coverage: 8:384/385 of query aligns to 10:378/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
25% identity, 98% coverage: 8:384/385 of query aligns to 6:374/377 of P44514
7lgpB Dape enzyme from shigella flexneri
26% identity, 98% coverage: 7:384/385 of query aligns to 7:375/377 of 7lgpB
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
28% identity, 66% coverage: 7:261/385 of query aligns to 5:258/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
28% identity, 66% coverage: 7:261/385 of query aligns to 5:258/376 of 4o23A
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
28% identity, 61% coverage: 44:276/385 of query aligns to 39:273/377 of 7t1qA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 42% coverage: 8:167/385 of query aligns to 8:167/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 52% coverage: 68:266/385 of query aligns to 99:298/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 48% coverage: 68:251/385 of query aligns to 75:265/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 64% coverage: 67:312/385 of query aligns to 74:320/408 of Q03154
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
28% identity, 95% coverage: 4:370/385 of query aligns to 5:351/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
28% identity, 95% coverage: 4:370/385 of query aligns to 6:346/360 of 2f7vA
7ljhA Structure of poly(aspartic acid) hydrolase pahz2 with zn+2 bound (see paper)
24% identity, 82% coverage: 50:365/385 of query aligns to 66:375/400 of 7ljhA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
34% identity, 35% coverage: 34:167/385 of query aligns to 31:165/265 of 4op4B
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
26% identity, 75% coverage: 66:353/385 of query aligns to 70:340/373 of 3rzaA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
36% identity, 20% coverage: 57:133/385 of query aligns to 76:152/458 of 2pokA
Sites not aligning to the query:
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
42% identity, 21% coverage: 68:148/385 of query aligns to 98:181/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
42% identity, 21% coverage: 68:148/385 of query aligns to 98:181/478 of 2zofA
Sites not aligning to the query:
>AZOBR_RS30425 FitnessBrowser__azobra:AZOBR_RS30425
MTAMGATLDILERLVAFPTVSRDSNLDLILWAKERLEAAGATTRLVPSEDGRKANLFASV
GPADRPGVLLSGHTDVVPVDGQAWTSDPFRLTRRAGNLYGRGTADMKGFVAAAMALAQRA
SGRTLSQPLHLALSYDEEVGCLGVRRLIDMMAALPVRPRFCIVGEPTLMQVVTAHKGKTA
LRIDCRGVECHSSLAPQGMNAIHMACDMLTGLRRLQERVQTEGSRDADYDVPWTTIHAGV
IQGGSALNIVPNHCRLDMEIRHLPQDPVEPLLDAVRAEAAAIETRARSAFPAAAVEIAEL
SSYPSLDTDGDSEVVSFVKALTGGNSLGKISFGTEGGLFQQRLSLPTVVCGPGSIGEAHK
PDEFIAEEQLAACDRMLDLLLTRLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory