Comparing AZOBR_RS30775 FitnessBrowser__azobra:AZOBR_RS30775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
50% identity, 86% coverage: 44:346/351 of query aligns to 15:314/316 of 3nipB
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
50% identity, 86% coverage: 44:346/351 of query aligns to 14:313/315 of 3niqA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
50% identity, 86% coverage: 44:346/351 of query aligns to 17:316/318 of Q9I6K2
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
43% identity, 87% coverage: 34:339/351 of query aligns to 4:309/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
43% identity, 87% coverage: 34:339/351 of query aligns to 7:312/319 of Q9I3S3
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
41% identity, 75% coverage: 76:339/351 of query aligns to 54:314/323 of 4dz4B
7lbaB E. Coli agmatinase (see paper)
40% identity, 77% coverage: 54:322/351 of query aligns to 35:289/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
40% identity, 77% coverage: 54:322/351 of query aligns to 28:282/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
40% identity, 77% coverage: 54:322/351 of query aligns to 18:272/294 of 7lolA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
35% identity, 85% coverage: 44:343/351 of query aligns to 12:308/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
35% identity, 85% coverage: 44:343/351 of query aligns to 4:300/301 of 1gq6B
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
39% identity, 77% coverage: 54:322/351 of query aligns to 14:262/284 of 7loxA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
31% identity, 84% coverage: 44:337/351 of query aligns to 54:351/378 of 7esrA
2ef5A Crystal structure of the arginase from thermus thermophilus
32% identity, 76% coverage: 70:337/351 of query aligns to 3:268/273 of 2ef5A
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 77% coverage: 71:339/351 of query aligns to 24:282/284 of Q57757
6dktA Crystal structure of arginase from bacillus subtilis
32% identity, 76% coverage: 70:337/351 of query aligns to 3:278/283 of 6dktA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
30% identity, 84% coverage: 43:338/351 of query aligns to 6:296/303 of 1wogA
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 63% coverage: 117:336/351 of query aligns to 114:336/342 of P46637
Sites not aligning to the query:
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
34% identity, 63% coverage: 117:336/351 of query aligns to 90:312/318 of 6vsuE
6dktE Crystal structure of arginase from bacillus subtilis
33% identity, 76% coverage: 70:337/351 of query aligns to 3:263/268 of 6dktE
>AZOBR_RS30775 FitnessBrowser__azobra:AZOBR_RS30775
MIDPQKLDRLRTKYSGSGGDDFHDPEFQRVAALQFSGGKRVQPFAGVSTLLDAPYRPDAA
DAADFGGLDIALIGVPMDLGVTNRAGARLGPRAVRGMERIGPYEHALRMVPAASCKLADV
GDVPLSSRFSLEACHGDILAFYNRVMDAGVVPLSVGGDHSITYSILKALGRERPVGMIHF
DAHCDTGGPYEGAKFHHGGPFRQAVLDGVLDPERTVQIGIRGSTEYLWEFSYDSGMTVIH
AEDIPERGIASVIETARKVVGDGPVYVSFDVDCLDPVFAPGTGTPEVGGLTTREALAILR
GLDGLDIIGGDVVEVAPQYDATTNTAHAGAQMLFEILCLSVRALANRQGRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory