Comparing AZOBR_RS30840 FitnessBrowser__azobra:AZOBR_RS30840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
29% identity, 88% coverage: 11:293/323 of query aligns to 6:284/314 of 2jgvB
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
29% identity, 88% coverage: 11:293/323 of query aligns to 10:288/318 of 2jg1A
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
29% identity, 88% coverage: 11:293/323 of query aligns to 7:285/315 of 2jg1C
Sites not aligning to the query:
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
33% identity, 90% coverage: 11:300/323 of query aligns to 4:290/309 of 3uqdB
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
33% identity, 90% coverage: 11:300/323 of query aligns to 4:290/309 of 3uqdA
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
33% identity, 90% coverage: 11:300/323 of query aligns to 4:290/309 of 3n1cA
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 90% coverage: 11:300/323 of query aligns to 4:290/309 of P06999
Sites not aligning to the query:
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
33% identity, 90% coverage: 11:300/323 of query aligns to 4:290/307 of 3uqeA
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
33% identity, 87% coverage: 11:292/323 of query aligns to 4:281/304 of 3cqdA
Sites not aligning to the query:
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
31% identity, 81% coverage: 11:273/323 of query aligns to 3:262/319 of 2f02A
Sites not aligning to the query:
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
29% identity, 96% coverage: 11:321/323 of query aligns to 3:317/320 of 2ajrA
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
26% identity, 97% coverage: 11:323/323 of query aligns to 3:308/309 of 3ie7A
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
27% identity, 88% coverage: 11:295/323 of query aligns to 3:273/298 of 3julA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 90% coverage: 8:298/323 of query aligns to 11:296/339 of P9WID3
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 85% coverage: 44:316/323 of query aligns to 104:376/379 of A1A6H3
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
27% identity, 85% coverage: 44:316/323 of query aligns to 38:310/313 of 6ilsB
Sites not aligning to the query:
3kzhA Crystal structure of a putative sugar kinase from clostridium perfringens
28% identity, 39% coverage: 196:322/323 of query aligns to 183:312/316 of 3kzhA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
29% identity, 44% coverage: 161:302/323 of query aligns to 150:293/312 of 3in1A
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
24% identity, 89% coverage: 24:309/323 of query aligns to 24:318/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
24% identity, 89% coverage: 24:309/323 of query aligns to 24:318/327 of 6a8bA
>AZOBR_RS30840 FitnessBrowser__azobra:AZOBR_RS30840
MSAPSTPRPGVVTVTLNAAIDQTLDVPGFAAGAVNRAVAETRTAGGKGINVAAFLAGASL
AGGATPVTATGFLGEENTAVFDALFRRRGIRDRCLRLAGRSRVNIKLVDREGHSVTDINL
PGLHVPAESWRGLLTVVDDLAVTNRTFVLSGSVPAGVPDTAYTEMVTALHRRGAFVVVDA
SGPPLRHAVAARPDMVKPNAAELAELLGRPLKDRAEVVRAARELSESGIALVVVSLGAEG
AVFVEGGRALLAMPPPVEVASTVGAGDAMVAGVVAARLEGMGLEDCARRGTAFAAGTLSR
LGPELPPPERLAELMRAVRVEEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory