Comparing AZOBR_RS30885 FitnessBrowser__azobra:AZOBR_RS30885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AB71 Fructose-bisphosphate aldolase class 2; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; Fructose-bisphosphate aldolase class II; Sedoheptulose bisphosphate aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 11 papers)
55% identity, 96% coverage: 7:352/359 of query aligns to 8:355/359 of P0AB71
Sites not aligning to the query:
1dosA Structure of fructose-bisphosphate aldolase (see paper)
55% identity, 96% coverage: 7:352/359 of query aligns to 7:354/358 of 1dosA
1b57A Class ii fructose-1,6-bisphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
54% identity, 96% coverage: 7:352/359 of query aligns to 7:342/346 of 1b57A
3qm3A 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
54% identity, 97% coverage: 7:356/359 of query aligns to 8:350/350 of 3qm3A
5vjeA Class ii fructose-1,6-bisphosphate aldolase of escherichia coli with d-glucitol 1,6-bisphosphate (see paper)
52% identity, 96% coverage: 7:352/359 of query aligns to 7:335/339 of 5vjeA
5gk5C Apo structure of fructose 1,6-bisphosphate aldolase from escherichia coli at 1.9 angstrom resolution
51% identity, 96% coverage: 7:352/359 of query aligns to 7:331/335 of 5gk5C
1gynA Class ii fructose 1,6-bisphosphate aldolase with cadmium (not zinc) in the active site (see paper)
51% identity, 96% coverage: 7:352/359 of query aligns to 7:329/333 of 1gynA
7rgnA Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
44% identity, 95% coverage: 8:347/359 of query aligns to 7:331/340 of 7rgnA
P36580 Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 95% coverage: 10:350/359 of query aligns to 10:352/358 of P36580
7v6gB Structure of candida albicans fructose-1,6-bisphosphate aldolase mutation c157s with cn39
44% identity, 95% coverage: 8:347/359 of query aligns to 7:329/338 of 7v6gB
Sites not aligning to the query:
7yvaB Crystal structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with lipoic acid
44% identity, 95% coverage: 8:347/359 of query aligns to 7:327/336 of 7yvaB
Sites not aligning to the query:
7v6fA Structure of candida albicans fructose-1,6-bisphosphate aldolase complexed with g3p
44% identity, 95% coverage: 8:347/359 of query aligns to 7:326/335 of 7v6fA
4delA Active site loop dynamics of a class iia fructose 1,6-bisphosphate aldolase from m. Tuberculosis (see paper)
43% identity, 97% coverage: 11:357/359 of query aligns to 2:341/345 of 4delA
Sites not aligning to the query:
3ekzA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
41% identity, 97% coverage: 11:357/359 of query aligns to 2:330/334 of 3ekzA
Sites not aligning to the query:
4a22A Structure of mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase bound to n-(4-hydroxybutyl)- glycolohydroxamic acid bis- phosphate (see paper)
41% identity, 97% coverage: 11:357/359 of query aligns to 2:328/329 of 4a22A
3elfA Structural characterization of tetrameric mycobacterium tuberculosis fructose 1,6-bisphosphate aldolase - substrate binding and catalysis mechanism of a class iia bacterial aldolase (see paper)
41% identity, 97% coverage: 11:357/359 of query aligns to 2:328/332 of 3elfA
Sites not aligning to the query:
4lv4A A noncompetitive inhibitor for m. Tuberculosis's class iia fructose 1, 6-bisphosphate aldolase (see paper)
37% identity, 97% coverage: 11:357/359 of query aligns to 2:316/320 of 4lv4A
Sites not aligning to the query:
1rv8B Class ii fructose-1,6-bisphosphate aldolase from thermus aquaticus in complex with cobalt (see paper)
30% identity, 93% coverage: 20:353/359 of query aligns to 8:305/305 of 1rv8B
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
26% identity, 87% coverage: 20:332/359 of query aligns to 9:261/285 of P13243
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
24% identity, 94% coverage: 18:356/359 of query aligns to 6:277/279 of 4to8A
>AZOBR_RS30885 FitnessBrowser__azobra:AZOBR_RS30885
MSAPTRLKPGVVTGEDYRALIAACQDGGYALPAVNVVGTNGINAVLEAAAKNRSDVIVQL
SNGGARFYAGEGMKDALQARILGAVSAAQHVHLLAEQYGVCVVLHTDHANKGLIPWVEGM
IDHGEEHFRRTGRPLFSSHMLDLSEESLDFNLSECARVLKRLAPLGMSLEIELGVTGGEE
DGIGSEDLDAANNAHLYTQPEDVLRAYEELSPIGHFSVAASFGNVHGVYAPGNVKLRPEI
LGASQALVAERHGGGAKPLALVFHGGSGSEKEKIAQAVGFGVFKMNIDTDTQFAFAESIG
GFVLENEAAFRHQIDPQSGKPLKKLYDPRKWLRLGEQGMVRRLDEAFADLGAAGKSLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory