Comparing AZOBR_RS30960 FitnessBrowser__azobra:AZOBR_RS30960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
5z9yB Crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp (see paper)
61% identity, 96% coverage: 1:240/250 of query aligns to 4:234/234 of 5z9yB
O31618 Thiazole synthase; EC 2.8.1.10 from Bacillus subtilis (strain 168) (see 2 papers)
49% identity, 99% coverage: 1:247/250 of query aligns to 6:254/256 of O31618
1tygA Structure of the thiazole synthase/this complex (see paper)
49% identity, 95% coverage: 1:237/250 of query aligns to 4:242/242 of 1tygA
4n6fA Crystal structure of amycolatopsis orientalis bexx complexed with g6p (see paper)
37% identity, 94% coverage: 1:234/250 of query aligns to 7:241/242 of 4n6fA
P62003 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Pyrococcus woesei (see 2 papers)
30% identity, 46% coverage: 97:211/250 of query aligns to 98:216/228 of P62003
Sites not aligning to the query:
1hg3A Crystal structure of tetrameric tim from pyrococcus woesei. (see paper)
30% identity, 46% coverage: 97:211/250 of query aligns to 97:215/224 of 1hg3A
Sites not aligning to the query:
5lntA Crystal structure of arabidopsis thaliana pdx1k166r-prei320 complex (see paper)
43% identity, 23% coverage: 169:226/250 of query aligns to 201:258/273 of 5lntA
Sites not aligning to the query:
Q03148 Pyridoxal 5'-phosphate synthase subunit SNZ1; PLP synthase subunit SNZ1; PDX1 homolog 1; Pdx1.1; p35; EC 4.3.3.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 23% coverage: 163:219/250 of query aligns to 196:254/297 of Q03148
Sites not aligning to the query:
>AZOBR_RS30960 FitnessBrowser__azobra:AZOBR_RS30960
IAGREFRSRLFLGTAGYPNQQVMLDALEASGSELVTLAIRRISLDGYSESLVDVIGDRAG
LLPNTAGCLTAKEAVLTAQLAREALGVDWIKLEVIGDRELLYPDVEELLRATEELVADGF
TVLPYCNDDPVTCRKLADLGAAAVMPLGAFIGSGLGIRNPHAIETICARSPVPVVLDAGI
GTASDAALAMELGCAAVLLNTAVSKARDPVRMAAAMRDAVAAGRAARLAGRMPKRAFAEA
SSPQLGLIGT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory