SitesBLAST
Comparing AZOBR_RS30970 FitnessBrowser__azobra:AZOBR_RS30970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
40% identity, 96% coverage: 9:366/374 of query aligns to 11:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (= M43), P46 (≠ A45), N49 (≠ V48), R243 (vs. gap), Y252 (= Y250), Y267 (≠ T265), R308 (= R306), R334 (= R332), I335 (≠ N333)
- binding flavin-adenine dinucleotide: I11 (= I9), V29 (≠ F27), D30 (= D28), P31 (≠ R29), E32 (≠ G30), K36 (≠ R34), A37 (= A36), S38 (= S37), V40 (≠ A39), S41 (≠ A40), A42 (≠ G41), G43 (= G42), M44 (= M43), A174 (= A172), A203 (= A203), W206 (= W206), I228 (≠ M228), Y252 (= Y250), R308 (= R306), S333 (≠ H331), R334 (= R332), I335 (≠ N333), G336 (= G334), V337 (≠ I335), Q338 (≠ L336)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
40% identity, 96% coverage: 9:366/374 of query aligns to 11:368/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (= I9), V29 (≠ F27), D30 (= D28), P31 (≠ R29), K36 (≠ R34), A37 (= A36), S38 (= S37), S41 (≠ A40), A42 (≠ G41), G43 (= G42), M44 (= M43), A174 (= A172), A203 (= A203), W206 (= W206), G226 (= G226), G306 (= G304), R308 (= R306), S333 (≠ H331), R334 (= R332), I335 (≠ N333), G336 (= G334), V337 (≠ I335), Q338 (≠ L336)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
32% identity, 93% coverage: 1:349/374 of query aligns to 4:344/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I4), G8 (= G5), G10 (= G7), V11 (= V8), I12 (= I9), V30 (≠ F27), E31 (≠ D28), K32 (≠ R29), E38 (≠ G35), A39 (= A36), S40 (= S37), A43 (= A40), G45 (= G42), L46 (≠ M43), V171 (= V174), G200 (≠ A203), G201 (= G204), W203 (= W206), G298 (= G304), R300 (= R306), P301 (= P307), Y326 (≠ H331), R327 (= R332), N328 (= N333), G329 (= G334), I330 (= I335)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
35% identity, 91% coverage: 12:350/374 of query aligns to 18:347/369 of S5FMM4
- G51 (≠ A45) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ V48) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ E76) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ A203) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (= I335) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V345) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
38% identity, 94% coverage: 15:365/374 of query aligns to 20:367/368 of 4yshB
- active site: A45 (= A40), M48 (= M43), L49 (= L44), Q52 (≠ C47), I262 (≠ V261), L283 (= L282), G305 (= G304), N335 (= N333), L338 (= L336)
- binding flavin-adenine dinucleotide: F32 (= F27), E33 (≠ D28), K34 (≠ R29), G40 (= G35), A41 (= A36), S42 (= S37), A45 (= A40), A46 (≠ G41), M48 (= M43), V178 (= V174), S206 (≠ A203), W209 (= W206), R307 (= R306), H332 (= H330), R334 (= R332), N335 (= N333), G336 (= G334), I337 (= I335), L338 (= L336)
- binding glycine: G249 (= G248), Y251 (= Y250), Y251 (= Y250), A264 (= A263), R307 (= R306), R334 (= R332), R334 (= R332)
Sites not aligning to the query:
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
38% identity, 94% coverage: 15:365/374 of query aligns to 20:367/370 of 4yshA
- active site: A45 (= A40), M48 (= M43), L49 (= L44), Q52 (≠ C47), I262 (≠ V261), L283 (= L282), G305 (= G304), N335 (= N333), L338 (= L336)
- binding flavin-adenine dinucleotide: F32 (= F27), E33 (≠ D28), K34 (≠ R29), G40 (= G35), A41 (= A36), S42 (= S37), A45 (= A40), A46 (≠ G41), G47 (= G42), M48 (= M43), V178 (= V174), S206 (≠ A203), G207 (= G204), W209 (= W206), R307 (= R306), H332 (= H330), R334 (= R332), N335 (= N333), G336 (= G334), I337 (= I335)
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
32% identity, 94% coverage: 15:365/374 of query aligns to 21:363/364 of 3if9A
- active site: A47 (≠ G41), G48 (= G42), M49 (= M43)
- binding flavin-adenine dinucleotide: E34 (≠ D28), S35 (≠ R29), T42 (≠ A36), T43 (≠ S37), A46 (= A40), A47 (≠ G41), G48 (= G42), M49 (= M43), P173 (≠ E173), V174 (= V174), S202 (≠ A203), G203 (= G204), W205 (= W206), F209 (≠ I210), G300 (= G304), R302 (= R306), H327 (= H330), F328 (≠ H331), R329 (= R332), N330 (= N333), G331 (= G334), I332 (= I335)
- binding glycolic acid: Y246 (= Y250), R302 (= R306), R329 (= R332)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
32% identity, 94% coverage: 15:365/374 of query aligns to 21:363/369 of O31616
- ES 34:35 (≠ DR 28:29) binding
- TT 42:43 (≠ AS 36:37) binding
- AGM 47:49 (≠ GGM 41:43) binding
- G51 (≠ A45) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (≠ V48) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (= V174) binding
- H244 (≠ G248) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R306) binding
- 327:333 (vs. 330:336, 86% identical) binding
- R329 (= R332) binding
Sites not aligning to the query:
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
32% identity, 94% coverage: 15:365/374 of query aligns to 21:363/364 of 1ng3A
- active site: A47 (≠ G41), G48 (= G42), M49 (= M43)
- binding acetylamino-acetic acid: Y246 (= Y250), R302 (= R306), R329 (= R332)
- binding flavin-adenine dinucleotide: F33 (= F27), E34 (≠ D28), S35 (≠ R29), R41 (≠ G35), T42 (≠ A36), T43 (≠ S37), A46 (= A40), A47 (≠ G41), G48 (= G42), M49 (= M43), V174 (= V174), S202 (≠ A203), G203 (= G204), W205 (= W206), F209 (≠ I210), G300 (= G304), R302 (= R306), H327 (= H330), R329 (= R332), N330 (= N333), G331 (= G334), I332 (= I335)
- binding phosphate ion: R89 (≠ D84), R254 (= R258)
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
38% identity, 94% coverage: 15:365/374 of query aligns to 21:369/377 of Q5L2C2
- EK 34:35 (≠ DR 28:29) binding
- AS 42:43 (= AS 36:37) binding
- AGM 47:49 (≠ GGM 41:43) binding
- V180 (= V174) binding
- R309 (= R306) binding
- 334:340 (vs. 330:336, 86% identical) binding
- R336 (= R332) binding
Sites not aligning to the query:
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
27% identity, 94% coverage: 1:350/374 of query aligns to 3:352/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G5), G9 (= G7), I10 (≠ V8), D30 (= D28), N32 (≠ G30), H33 (≠ A31), K36 (≠ R34), A37 (≠ G35), T38 (≠ A36), A40 (≠ H38), G41 (≠ A39), A42 (= A40), G43 (= G41), V44 (≠ G42), Y174 (≠ V174), A203 (= A203), W206 (= W206), I210 (= I210), Y250 (= Y250), G305 (= G304), R307 (= R306), G333 (≠ H331), A334 (≠ R332), S335 (≠ N333), G336 (= G334), L337 (≠ I335), T338 (≠ L336)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 94% coverage: 3:352/374 of query aligns to 30:386/824 of Q8GAI3
- W66 (vs. gap) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (= H38) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
23% identity, 94% coverage: 14:365/374 of query aligns to 20:370/374 of 1y56B
- active site: F44 (≠ H38), G47 (= G41), T48 (≠ A46), H224 (≠ G226), P239 (≠ R241), G305 (= G304), M338 (≠ L336)
- binding flavin-adenine dinucleotide: I33 (≠ F27), E34 (≠ D28), K35 (≠ R29), S42 (≠ A36), T43 (≠ S37), R45 (≠ A39), C46 (≠ A40), G47 (= G41), G49 (≠ C47), E170 (= E173), V171 (= V174), T200 (≠ A203), N201 (≠ G204), W203 (= W206), G305 (= G304), Y306 (≠ F305), Y307 (≠ R306), G334 (≠ R332), H335 (≠ N333), G336 (= G334), F337 (≠ I335), M338 (≠ L336)
- binding flavin mononucleotide: F44 (≠ H38), R45 (≠ A39), I260 (≠ L260), R301 (≠ E300), W303 (= W302)
Sites not aligning to the query:
7xxpA F316a-glycine-streptothricin f complex (see paper)
29% identity, 98% coverage: 1:365/374 of query aligns to 4:392/482 of 7xxpA
- binding flavin-adenine dinucleotide: V7 (≠ I4), G8 (= G5), N9 (≠ A6), G10 (= G7), V11 (= V8), L12 (≠ I9), G33 (≠ D28), R37 (≠ A32), Q38 (≠ G33), A41 (= A36), T42 (≠ S37), A45 (= A40), A47 (≠ G42), M48 (= M43), D189 (≠ E173), A190 (≠ V174), A220 (= A203), G221 (= G204), R223 (≠ W206), G331 (= G304), R333 (= R306), P334 (= P307), T357 (≠ H330), Y358 (≠ H331), R359 (= R332), D360 (≠ N333), G361 (= G334), L362 (≠ I335), H363 (≠ L336)
- binding glycine: H275 (≠ Y250), R333 (= R306), R359 (= R332)
- binding Streptothricin F: N290 (≠ T265), R297 (= R268), S301 (≠ T275), E303 (≠ G277)
Sites not aligning to the query:
8griF Orf1-e312a-glycine-glycylthricin (see paper)
28% identity, 98% coverage: 1:365/374 of query aligns to 4:392/482 of 8griF
- binding flavin-adenine dinucleotide: V7 (≠ I4), G8 (= G5), N9 (≠ A6), G10 (= G7), V11 (= V8), L12 (≠ I9), G33 (≠ D28), R37 (≠ A32), Q38 (≠ G33), A41 (= A36), T42 (≠ S37), A45 (= A40), A47 (≠ G42), M48 (= M43), D189 (≠ E173), A190 (≠ V174), A220 (= A203), G221 (= G204), R223 (≠ W206), G331 (= G304), R333 (= R306), T357 (≠ H330), Y358 (≠ H331), R359 (= R332), D360 (≠ N333), G361 (= G334), L362 (≠ I335), H363 (≠ L336)
- binding glycine: H275 (≠ Y250), R333 (= R306), R359 (= R332)
- binding [(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(~{E})-[(3~{a}~{S},7~{R},7~{a}~{S})-7-oxidanyl-4-oxidanylidene-3,3~{a},5,6,7,7~{a}-hexahydro-1~{H}-imidazo[4,5-c]pyridin-2-ylidene]amino]-5-(2-azanylethanoylamino)-2-(hydroxymethyl)-4-oxidanyl-oxan-3-yl] carbamate: C272 (≠ P247), N290 (≠ T265), S301 (≠ D272)
Sites not aligning to the query:
- binding [(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(~{E})-[(3~{a}~{S},7~{R},7~{a}~{S})-7-oxidanyl-4-oxidanylidene-3,3~{a},5,6,7,7~{a}-hexahydro-1~{H}-imidazo[4,5-c]pyridin-2-ylidene]amino]-5-(2-azanylethanoylamino)-2-(hydroxymethyl)-4-oxidanyl-oxan-3-yl] carbamate: 414, 457, 461
7xxmA Orf1-glycine-4-aminobutylthricin complex (see paper)
28% identity, 98% coverage: 1:365/374 of query aligns to 4:392/482 of 7xxmA
- binding flavin-adenine dinucleotide: V7 (≠ I4), G8 (= G5), N9 (≠ A6), G10 (= G7), V11 (= V8), L12 (≠ I9), G33 (≠ D28), R37 (≠ A32), Q38 (≠ G33), G40 (= G35), A41 (= A36), T42 (≠ S37), A44 (= A39), A45 (= A40), M48 (= M43), D189 (≠ E173), A190 (≠ V174), A220 (= A203), G221 (= G204), R223 (≠ W206), G246 (≠ K225), G331 (= G304), R333 (= R306), T357 (≠ H330), Y358 (≠ H331), R359 (= R332), D360 (≠ N333), G361 (= G334), L362 (≠ I335), H363 (≠ L336)
- binding glycine: R333 (= R306), R359 (= R332)
- binding [(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(~{E})-[(3~{a}~{S},7~{R},7~{a}~{S})-7-oxidanyl-4-oxidanylidene-3,3~{a},5,6,7,7~{a}-hexahydro-1~{H}-imidazo[4,5-c]pyridin-2-ylidene]amino]-5-(4-azanylbutanoylamino)-2-(hydroxymethyl)-4-oxidanyl-oxan-3-yl] carbamate: N290 (≠ T265), R297 (= R268), S301 (≠ T275), E303 (≠ G277)
Sites not aligning to the query:
- binding [(2~{R},3~{R},4~{S},5~{R},6~{R})-6-[(~{E})-[(3~{a}~{S},7~{R},7~{a}~{S})-7-oxidanyl-4-oxidanylidene-3,3~{a},5,6,7,7~{a}-hexahydro-1~{H}-imidazo[4,5-c]pyridin-2-ylidene]amino]-5-(4-azanylbutanoylamino)-2-(hydroxymethyl)-4-oxidanyl-oxan-3-yl] carbamate: 414, 457, 461
7fgpA Crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form)
26% identity, 99% coverage: 3:372/374 of query aligns to 7:379/379 of 7fgpA
- binding flavin-adenine dinucleotide: G9 (= G5), G11 (= G7), V12 (= V8), I13 (= I9), E32 (≠ D28), A33 (≠ R29), T40 (≠ A36), S41 (= S37), V43 (≠ A39), S44 (≠ A40), Y45 (≠ G41), A46 (≠ G42), W47 (≠ M43), E97 (≠ T90), K179 (≠ E173), V180 (= V174), S210 (≠ A203), G211 (= G204), W213 (= W206), R314 (= R306), H339 (= H331), S340 (≠ N333), G341 (= G334), V342 (≠ I335), T343 (≠ L336)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
26% identity, 98% coverage: 1:366/374 of query aligns to 7:393/830 of Q9AGP8
- IV 14:15 (≠ VI 8:9) binding
- DQ 35:36 (≠ DR 28:29) binding
- STSH 45:48 (≠ GASH 35:38) binding
- L52 (≠ A46) binding
- V174 (= V174) binding
- H225 (≠ G226) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (vs. gap) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ ---H 330) binding
Sites not aligning to the query:
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
26% identity, 98% coverage: 1:366/374 of query aligns to 4:390/827 of 1pj7A
- active site: H222 (≠ G226), Y256 (vs. gap)
- binding flavin-adenine dinucleotide: G8 (= G5), G10 (= G7), I11 (≠ V8), V12 (≠ I9), D32 (= D28), Q33 (≠ R29), G41 (≠ R34), S42 (≠ G35), T43 (≠ A36), H45 (= H38), P47 (≠ A40), L49 (≠ A46), T170 (≠ E173), V171 (= V174), A200 (= A203), G201 (= G204), W203 (= W206), H222 (≠ G226), Y256 (vs. gap), I331 (≠ F305), V357 (vs. gap), W358 (vs. gap), V359 (vs. gap), T360 (≠ H330)
Sites not aligning to the query:
- active site: 549
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 98% coverage: 1:366/374 of query aligns to 4:390/827 of 3gsiA
- active site: H222 (≠ G226), Y256 (vs. gap)
- binding flavin-adenine dinucleotide: G10 (= G7), I11 (≠ V8), V12 (≠ I9), D32 (= D28), Q33 (≠ R29), G41 (≠ R34), S42 (≠ G35), T43 (≠ A36), H45 (= H38), P47 (≠ A40), L49 (≠ A46), T170 (≠ E173), V171 (= V174), A200 (= A203), G201 (= G204), W203 (= W206), H222 (≠ G226), Y256 (vs. gap), G330 (= G304), I331 (≠ F305), F332 (≠ R306), V357 (vs. gap), W358 (vs. gap), V359 (vs. gap), T360 (≠ H330)
- binding magnesium ion: D254 (vs. gap)
Sites not aligning to the query:
- active site: 549
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
Query Sequence
>AZOBR_RS30970 FitnessBrowser__azobra:AZOBR_RS30970
IAVIGAGVIGLSIAWRLAAAGCRVEVFDRGAAGRGASHAAGGMLAACVETEPGEESLLPL
TRASQDLWPAFAAELEAASGMAVDLRGEGTMVIALNADDAAKVRFLHDFQTRLGLPVEWL
SGAEVRRREPYLQPGVAGALFCAGDHQVDNRKVATALHAAALRAGAVVHEYAEVSRIEVR
GGRAVGIQVEDRLVEADQVVLAAGAWSGWIDGLSPAVRPPVRPVKGQMLCLRMDARLPLL
RHVVWTPGTYLIPRLDGRLLVGATTEERGFDDRLTAGGQFALLEGAWRALPGIAELPIEE
AWAGFRPGTRDDAPILGLSEVEGLVYATGHHRNGILLTPVTADSVARLVLTGEADPVIRP
FALDRFAQPKGAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory