Comparing AZOBR_RS31020 FitnessBrowser__azobra:AZOBR_RS31020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
42% identity, 90% coverage: 5:299/329 of query aligns to 4:298/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
42% identity, 90% coverage: 5:299/329 of query aligns to 3:287/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 97% coverage: 4:323/329 of query aligns to 2:328/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 78% coverage: 4:259/329 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 78% coverage: 4:259/329 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 78% coverage: 4:259/329 of query aligns to 2:247/250 of 7z16I
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 75% coverage: 12:258/329 of query aligns to 29:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 75% coverage: 12:258/329 of query aligns to 29:265/382 of 7aheC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 77% coverage: 5:258/329 of query aligns to 1:243/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 77% coverage: 5:258/329 of query aligns to 2:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 77% coverage: 5:258/329 of query aligns to 2:244/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 77% coverage: 5:258/329 of query aligns to 2:244/344 of 6cvlD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 79% coverage: 3:263/329 of query aligns to 15:255/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 73% coverage: 20:259/329 of query aligns to 12:239/240 of 4ymuJ
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
29% identity, 74% coverage: 12:253/329 of query aligns to 29:260/260 of 7ahdC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 78% coverage: 4:259/329 of query aligns to 1:239/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 74% coverage: 18:260/329 of query aligns to 15:247/375 of 2d62A
1g291 Malk (see paper)
33% identity, 73% coverage: 20:260/329 of query aligns to 14:244/372 of 1g291
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 71% coverage: 18:251/329 of query aligns to 15:224/353 of 1vciA
8g4cB Bceabs atpgs high res tm (see paper)
28% identity, 70% coverage: 5:235/329 of query aligns to 3:214/248 of 8g4cB
>AZOBR_RS31020 FitnessBrowser__azobra:AZOBR_RS31020
MTAPLLRVDGLKTHFLTRAGTVKAVDGVDLRLDRGEILGLVGESGSGKSVTGQSILGLVD
PPGQVVGGRVLFQGEDLVGAGEKRLRAIRGRRIAMIFQDPMMTLNPVLSIGTQMVEAVRA
HDKVSRAEAWERSRRALARVGIASPDERLASYPHQFSGGMRQRVAIAIALLHSPDLIIAD
EPTTALDVTIQAQILFEVQTLCRETGTALIWVTHDLAVVSALADRVAVMYAGRVVETGTV
AEIIGNPRHPYTRGLLESVPSRNRRGVPLRSIPGMTPSVLDLPEGCAFRPRCDRSTGACT
VMPELSGEREDRAWRCWNPVAAEVRGDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory