Comparing AZOBR_RS31025 FitnessBrowser__azobra:AZOBR_RS31025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 89% coverage: 38:335/335 of query aligns to 20:324/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 88% coverage: 38:331/335 of query aligns to 19:309/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
34% identity, 82% coverage: 36:309/335 of query aligns to 17:305/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 71% coverage: 37:274/335 of query aligns to 16:249/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 71% coverage: 37:274/335 of query aligns to 17:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 71% coverage: 37:274/335 of query aligns to 17:250/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 71% coverage: 37:274/335 of query aligns to 17:250/344 of 6cvlD
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 68% coverage: 40:266/335 of query aligns to 17:244/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 68% coverage: 40:266/335 of query aligns to 17:244/250 of 7z18I
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 75% coverage: 23:274/335 of query aligns to 9:236/353 of 1vciA
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 68% coverage: 40:266/335 of query aligns to 17:244/250 of 7z16I
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 79% coverage: 5:268/335 of query aligns to 16:250/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 79% coverage: 7:269/335 of query aligns to 3:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 79% coverage: 7:269/335 of query aligns to 3:266/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
31% identity, 77% coverage: 7:263/335 of query aligns to 3:260/260 of 7ahdC
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 68% coverage: 38:266/335 of query aligns to 15:238/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 68% coverage: 38:266/335 of query aligns to 15:238/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 68% coverage: 38:266/335 of query aligns to 15:238/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 68% coverage: 38:266/335 of query aligns to 15:238/242 of 2oljA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 69% coverage: 38:268/335 of query aligns to 13:238/240 of 4ymuJ
Sites not aligning to the query:
>AZOBR_RS31025 FitnessBrowser__azobra:AZOBR_RS31025
MTTPPIIELNGLTKRFSRKLDVVERFARRLGAAIDDRAVQAVSGVDLSIAEGEVVGLVGE
SGCGKSTLGRMVAGILPPSAGTLRWRGRDLRELSPADRHHANLKIQMVFQDPMASLNPRL
RVADIVGEAPVVHGLVPRREAEDYVAATLRQVGLDPAYLRRYPHQFSGGQRQRIGIARAL
AVKPDVLVCDESVAALDVSIQAQIINLFMRLREELSLTYLFISHDLGVVEHISDRTAIMY
LGRIVELAPTPELFDKPNHPYAKALLDEAPRVSVEKRRFAPIRGEIPSPLDPPSGCAFHP
RCPHAMPRCSAERPALREIAPRRWSACHLNETTGP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory