Comparing AZOBR_RS31075 FitnessBrowser__azobra:AZOBR_RS31075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
63% identity, 97% coverage: 3:282/289 of query aligns to 3:280/288 of 2ux8G
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
56% identity, 97% coverage: 3:282/289 of query aligns to 3:247/255 of 2ux8A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
50% identity, 95% coverage: 5:278/289 of query aligns to 5:278/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
50% identity, 98% coverage: 5:286/289 of query aligns to 3:280/282 of 5ve7A
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
49% identity, 92% coverage: 2:267/289 of query aligns to 5:271/281 of 8f73E
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
43% identity, 97% coverage: 5:285/289 of query aligns to 2:286/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
43% identity, 97% coverage: 5:285/289 of query aligns to 2:286/290 of 6k8dA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
45% identity, 93% coverage: 5:274/289 of query aligns to 2:264/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
45% identity, 93% coverage: 5:274/289 of query aligns to 2:264/265 of 3jukA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
42% identity, 97% coverage: 5:285/289 of query aligns to 2:281/285 of 6ikzB
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
43% identity, 96% coverage: 9:285/289 of query aligns to 6:284/291 of 8b6dA
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
40% identity, 98% coverage: 5:287/289 of query aligns to 3:288/299 of 2pa4B
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
41% identity, 96% coverage: 9:285/289 of query aligns to 6:279/286 of 8b68A
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
25% identity, 90% coverage: 6:266/289 of query aligns to 4:236/295 of 6n0uA
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
24% identity, 81% coverage: 6:240/289 of query aligns to 2:206/293 of 5ifyA
Sites not aligning to the query:
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
28% identity, 80% coverage: 5:234/289 of query aligns to 2:201/290 of 1h5tA
Sites not aligning to the query:
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
28% identity, 80% coverage: 5:234/289 of query aligns to 2:201/290 of 1h5rA
Sites not aligning to the query:
1h5sB Thymidylyltransferase complexed with tmp (see paper)
28% identity, 80% coverage: 5:234/289 of query aligns to 3:202/291 of 1h5sB
Sites not aligning to the query:
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 80% coverage: 5:234/289 of query aligns to 3:202/292 of P26393
Sites not aligning to the query:
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
26% identity, 80% coverage: 5:234/289 of query aligns to 3:202/290 of 3pkpA
>AZOBR_RS31075 FitnessBrowser__azobra:AZOBR_RS31075
MRKPVRKVVFPVAGLGTRFLPATKAIPKEMLPLVDRPLLQHAVEEARAAGIEDFVFVTGR
SKRAIEDHFDTDTELNRTLEERGKQDALEVVRDSEIAPGRCFYTRQQVPLGLGHAVWCAR
AVIGNDPFAIVLPDDFVQGDTPCLKQMVEAYNEVGGNIVAVVDVPRERTSSYGILDVEKD
DGRLATVRGLVEKPKPEEAPSTLSIIGRYILQPEVFDHLEKQQRGAGNEIQLTDAMAKLI
GTQPFHGLRFEGTRYDCGDKVGFIEATLAHALRRPDMADKVRDMLRKYC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory