Comparing AZOBR_RS31105 FitnessBrowser__azobra:AZOBR_RS31105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
39% identity, 98% coverage: 9:392/393 of query aligns to 13:393/398 of 7poaA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 87% coverage: 40:380/393 of query aligns to 285:621/653 of Q5W264
Sites not aligning to the query:
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 91% coverage: 30:386/393 of query aligns to 28:380/384 of P12998
Sites not aligning to the query:
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
39% identity, 91% coverage: 30:386/393 of query aligns to 27:379/383 of 2g6wA
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
38% identity, 95% coverage: 13:386/393 of query aligns to 17:379/383 of 1djeA
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
38% identity, 95% coverage: 13:386/393 of query aligns to 17:379/383 of 1dj9A
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
35% identity, 88% coverage: 42:388/393 of query aligns to 67:410/419 of Q0P5L8
Sites not aligning to the query:
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
34% identity, 88% coverage: 39:385/393 of query aligns to 43:388/400 of 7v58B
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
32% identity, 93% coverage: 29:392/393 of query aligns to 30:392/396 of 3tqxA
P18079 5-aminolevulinate synthase; 5-aminolevulinic acid synthase; Delta-ALA synthase; Delta-aminolevulinate synthase; EC 2.3.1.37 from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
35% identity, 93% coverage: 28:392/393 of query aligns to 40:399/409 of P18079
Sites not aligning to the query:
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
35% identity, 93% coverage: 28:392/393 of query aligns to 40:399/399 of 2bwoB
Sites not aligning to the query:
Q8GW43 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Biotin synthase 4; Biotin synthase F; AtbioF; EC 2.3.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 89% coverage: 40:389/393 of query aligns to 102:458/476 of Q8GW43
Sites not aligning to the query:
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
35% identity, 93% coverage: 28:391/393 of query aligns to 40:398/398 of 2bwpA
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
35% identity, 88% coverage: 39:385/393 of query aligns to 44:389/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
35% identity, 88% coverage: 39:385/393 of query aligns to 41:386/398 of P0AB77
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
34% identity, 92% coverage: 29:389/393 of query aligns to 33:392/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
34% identity, 92% coverage: 29:389/393 of query aligns to 33:392/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
34% identity, 92% coverage: 29:389/393 of query aligns to 33:392/399 of 7bxqA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
31% identity, 93% coverage: 26:389/393 of query aligns to 29:392/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
31% identity, 93% coverage: 26:389/393 of query aligns to 29:392/394 of 8h21A
>AZOBR_RS31105 FitnessBrowser__azobra:AZOBR_RS31105
MSLLDPLFRQHLDRLDRRHTRRTLLPVRPEGAGRIRRGGRTLLNFSSNDYLGLASHPLLV
ERAGDWTRRWGAGATASRLVCGTLELHAEVEAKLARLKGTEAALLFNSGWQANAAVLPAL
FDRELLGVEAQVFTDRLNHASLHHGCAAAGVRQIRFRHNDLDHLETLLSQRTGEPGMRFI
VTESVFSMDGDRADVPALAALAERHGAFLFLDEAHATGVLGPRGMGLAALGGGRVDLAMG
TFSKALGGFGAYVAGSRELCDYLVNRCGGLIYATALPPAVLGAMDAALDLVPKLDAERAR
LQAMAERLRTALHGLGVATAGSSTQIVPAITGAEEDALALGRRLEERGILGIAIRPPTVP
PGTSRLRFALSAAHTDADLETLVSAVADAWSRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory