SitesBLAST
Comparing AZOBR_RS31120 FitnessBrowser__azobra:AZOBR_RS31120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
41% identity, 99% coverage: 2:429/434 of query aligns to 3:420/429 of P12995
- Y17 (≠ F16) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W51) binding
- GS 112:113 (= GS 111:112) binding
- Y144 (= Y144) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D147) mutation to N: Loss of aminotransferase activity.
- D245 (= D248) binding
- R253 (= R256) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K277) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G311) binding
- PT 308:309 (≠ HS 312:313) binding
- R391 (= R400) binding ; mutation to A: Reduces aminotransferase activity.
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
41% identity, 99% coverage: 2:429/434 of query aligns to 3:420/429 of 6ed7A
- active site: Y17 (≠ F16), Y144 (= Y144), D245 (= D248), K274 (= K277)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F16), W52 (= W51), W52 (= W51), Y144 (= Y144), D147 (= D147), A217 (= A220), K274 (= K277), R391 (= R400), F393 (≠ L402), F393 (≠ L402)
- binding pyridoxal-5'-phosphate: G112 (= G111), S113 (= S112), Y144 (= Y144), H145 (= H145), D245 (= D248), I247 (≠ V250), K274 (= K277)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
41% identity, 99% coverage: 2:429/434 of query aligns to 3:420/429 of 1dtyA
- active site: Y17 (≠ F16), Y144 (= Y144), E211 (= E214), D245 (= D248), A248 (≠ M251), K274 (= K277), Y398 (= Y407)
- binding pyridoxal-5'-phosphate: G112 (= G111), S113 (= S112), Y144 (= Y144), H145 (= H145), D245 (= D248), I247 (≠ V250), K274 (= K277)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
41% identity, 99% coverage: 2:429/434 of query aligns to 3:408/416 of 1qj3A
- active site: Y17 (≠ F16), Y144 (= Y144), E201 (= E214), D235 (= D248), A238 (≠ M251), K264 (= K277), Y386 (= Y407)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F16), W52 (= W51), Y144 (= Y144), K264 (= K277), R379 (= R400), F381 (≠ L402)
- binding pyridoxal-5'-phosphate: G112 (= G111), S113 (= S112), Y144 (= Y144), H145 (= H145), G146 (= G146), D235 (= D248), I237 (≠ V250), A238 (≠ M251), K264 (= K277)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
41% identity, 99% coverage: 2:429/434 of query aligns to 3:419/427 of 1mlzA
- active site: Y17 (≠ F16), Y144 (= Y144), E210 (= E214), D244 (= D248), A247 (≠ M251), K273 (= K277), Y397 (= Y407)
- binding pyridoxal-5'-phosphate: G112 (= G111), S113 (= S112), Y144 (= Y144), H145 (= H145), D244 (= D248), I246 (≠ V250), K273 (= K277), P307 (≠ H312), T308 (≠ S313)
- binding trans-amiclenomycin: W52 (= W51), W53 (= W52), Y144 (= Y144), K273 (= K277), R390 (= R400), F392 (≠ L402)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
41% identity, 99% coverage: 2:429/434 of query aligns to 3:419/427 of 1mlyA
- active site: Y17 (≠ F16), Y144 (= Y144), E210 (= E214), D244 (= D248), A247 (≠ M251), K273 (= K277), Y397 (= Y407)
- binding cis-amiclenomycin: W52 (= W51), W53 (= W52), K273 (= K277), R390 (= R400), F392 (≠ L402)
- binding pyridoxal-5'-phosphate: G112 (= G111), S113 (= S112), Y144 (= Y144), H145 (= H145), D244 (= D248), I246 (≠ V250), K273 (= K277), P307 (≠ H312), T308 (≠ S313)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:420/425 of 4w1vA
- active site: Y18 (≠ F16), Y147 (= Y144), E210 (= E214), D244 (= D248), A247 (≠ M251), K273 (= K277), Y397 (= Y407)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P15), Y18 (≠ F16), W54 (= W51), M81 (≠ I78), G83 (≠ A80), Y147 (= Y144), G306 (= G311), P307 (≠ H312), T308 (≠ S313), F392 (≠ L402)
- binding pyridoxal-5'-phosphate: G114 (= G111), S115 (= S112), Y147 (= Y144), H148 (= H145), E210 (= E214), D244 (= D248), I246 (≠ V250), K273 (= K277)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:420/425 of 4cxrA
- active site: Y18 (≠ F16), Y147 (= Y144), E210 (= E214), D244 (= D248), A247 (≠ M251), K273 (= K277), Y397 (= Y407)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F16), W54 (= W51), W55 (= W52), A216 (= A220)
- binding pyridoxal-5'-phosphate: G114 (= G111), S115 (= S112), Y147 (= Y144), H148 (= H145), E210 (= E214), D244 (= D248), I246 (≠ V250), K273 (= K277), P307 (≠ H312), T308 (≠ S313)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:422/427 of 4cxqA
- active site: Y18 (≠ F16), Y149 (= Y144), E212 (= E214), D246 (= D248), A249 (≠ M251), K275 (= K277), Y399 (= Y407)
- binding 7-keto-8-aminopelargonic acid: W56 (= W51), Y149 (= Y144), G308 (= G311), T310 (≠ S313), R392 (= R400)
- binding pyridoxal-5'-phosphate: G116 (= G111), S117 (= S112), Y149 (= Y144), H150 (= H145), G151 (= G146), E212 (= E214), D246 (= D248), I248 (≠ V250), K275 (= K277), P309 (≠ H312), T310 (≠ S313)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 5kgtA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I78), G86 (≠ A80), G309 (= G311), T311 (≠ S313)
- binding pyridoxal-5'-phosphate: S116 (≠ N110), G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 5kgsA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), D162 (≠ G155), G165 (≠ S158), G166 (= G159), P310 (≠ H312), T311 (≠ S313), F395 (≠ L402)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4xjpA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), G165 (≠ S158), G166 (= G159), A219 (= A220), G220 (≠ S221), G309 (= G311), F395 (≠ L402)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4xjmA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), M158 (= M152), G165 (≠ S158), G166 (= G159), M167 (≠ F160), W171 (≠ F164), M307 (≠ A309), G309 (= G311), T311 (≠ S313)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4xjlA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), C161 (≠ A154), G165 (≠ S158), G166 (= G159), A219 (= A220)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4wygA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (≠ F16), W57 (= W51), W58 (= W52), Y150 (= Y144), A219 (= A220), F395 (≠ L402)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4wyeA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a dsf fragment hit (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4wyeA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding phenyl(piperidin-4-yl)methanone: Y18 (≠ F16), W57 (= W51), W58 (= W52), A219 (= A220), F395 (≠ L402), Y400 (= Y407)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4w1xA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 1-(4-(4-(3-chlorobenzoyl) piperazin-1-yl)phenyl)ethanone (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4w1xA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 1-{4-[4-(3-chlorobenzoyl)piperazin-1-yl]phenyl}ethanone: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), G165 (≠ S158), G166 (= G159), A219 (= A220), G309 (= G311), T311 (≠ S313)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4w1wA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with 7-(diethylamino)-3- (thiophene-2-carbonyl)-2h-chromen-2-one (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/429 of 4w1wA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding 7-(diethylamino)-3-(thiophen-2-ylcarbonyl)-2H-chromen-2-one: P17 (= P15), Y18 (≠ F16), W57 (= W51), M84 (≠ I78), G86 (≠ A80), Y150 (= Y144), G165 (≠ S158), G309 (= G311), P310 (≠ H312), R393 (= R400)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), G152 (= G146), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
4wydA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase from mycobacterium tuberculosis complexed with a fragment from dsf screening (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 7:423/430 of 4wydA
- active site: Y18 (≠ F16), Y150 (= Y144), E213 (= E214), D247 (= D248), A250 (≠ M251), K276 (= K277), Y400 (= Y407)
- binding N-methyl-1-[4-(1H-pyrazol-1-ylmethyl)phenyl]methanamine: Y18 (≠ F16), W57 (= W51), W58 (= W52), Y150 (= Y144), A219 (= A220), G309 (= G311), T311 (≠ S313), F395 (≠ L402)
- binding pyridoxal-5'-phosphate: G117 (= G111), S118 (= S112), Y150 (= Y144), H151 (= H145), E213 (= E214), D247 (= D248), I249 (≠ V250), K276 (= K277), P310 (≠ H312), T311 (≠ S313)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 98% coverage: 5:430/434 of query aligns to 14:430/437 of P9WQ81
- Y25 (≠ F16) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W51) binding
- Y157 (= Y144) binding
- K283 (= K277) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G311) binding
Query Sequence
>AZOBR_RS31120 FitnessBrowser__azobra:AZOBR_RS31120
MTDTVSLDQRHVWHPFTQAQTAPEPLAVTHGKGASLFTEDGREILDLISSWWVNLHGHAH
PAVAGAIAEQAHRLEQVIFADFTHSPAARLAARLAEVLPGGLGRVFYSDNGSTAVEVALK
LAWQYWRNKGEGQRRRFLAFEGSYHGDTFGAMAAGVGSGFYAPFQELLFAVDRMPYPATW
DGDPEVEAKEAAALDWLDRWLATNGAELVAVIIEPLVQGASGMRFCRPEFLRAMAARVRA
AGGLVIFDEVMTGFGRTGALFASQKAGVAPDLICLSKGLTGGFLPLSVTACGASIYEAFL
GAGFDRAFAHGHSFTANPLGCAAALASLELTTSAETTANLARIETRHRAAIADLSGHPKL
SRGRVMGTIAAIEVTDAQGYTAAVGQTLKRFFLERGLLLRPLGPVIYLLPPYCVTDGQLD
RAYAAIRDAADTLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory