Comparing AZOBR_RS31210 FitnessBrowser__azobra:AZOBR_RS31210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
41% identity, 92% coverage: 12:484/516 of query aligns to 4:470/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 44% coverage: 11:235/516 of query aligns to 1:223/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 43% coverage: 12:235/516 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 43% coverage: 12:235/516 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 43% coverage: 12:235/516 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 43% coverage: 12:235/516 of query aligns to 3:225/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 42% coverage: 11:229/516 of query aligns to 3:221/280 of 5x40A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 47% coverage: 3:246/516 of query aligns to 8:249/378 of P69874
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
29% identity, 46% coverage: 12:249/516 of query aligns to 4:231/285 of 4yerA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 43% coverage: 12:235/516 of query aligns to 1:228/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 42% coverage: 12:229/516 of query aligns to 1:217/240 of 4ymuJ
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 43% coverage: 12:235/516 of query aligns to 2:229/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 43% coverage: 12:235/516 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 43% coverage: 12:235/516 of query aligns to 2:229/344 of 3tuiC
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 12:234/516 of query aligns to 4:236/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 12:234/516 of query aligns to 4:236/253 of 1g9xB
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
31% identity, 43% coverage: 12:234/516 of query aligns to 3:225/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
31% identity, 43% coverage: 12:234/516 of query aligns to 3:225/229 of 6z67B
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 42% coverage: 13:227/516 of query aligns to 4:220/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 42% coverage: 13:227/516 of query aligns to 4:220/353 of 1oxvA
>AZOBR_RS31210 FitnessBrowser__azobra:AZOBR_RS31210
MTDPTPTASPPLLAIRGLSKAFLGVQALDGVDFTVRHGEIHALLGENGAGKSTLIKTLTG
VYQRDAGTVTLEGRAIAPRGVEEAQRLHIGTVYQEVNLLPNLSVAENLFLGRQPMRFGLV
DRGAMRRRARAVLIPYGLTLDVTAPLGRFSVATQQIVAIARAVDMSAKVLILDEPTASLD
AQEVAVLFKVMRTLRSRGIGIVFVTHFLDQVYALCDRITVLRNGRLVGERRTAELPRLDL
VAMMLGRELEAVAHRIAPPADDAEEDARPPLVRFRGYGKARSVEPFDLDIRPGEVVGLAG
LLGSGRTETARLVFGMDRADRGEAAVDGQAVRLRGPRDAIRLGFGFCPEDRKKEGIVGAL
SVRENIILALQARQGWLRPIPRCRQEEIADRFIRLLDIRTPHAEQPIQLLSGGNQQKALL
ARWLATEPRLLILDEPTRGIDVGAHAEIIRLIERLCADGMALLVVSSELEEIVAYSRRVV
VLRDRRHVAELRGGEVAVDRIVAAIASESVPEEPRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory