Comparing AZOBR_RS31215 FitnessBrowser__azobra:AZOBR_RS31215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
74% identity, 91% coverage: 29:319/321 of query aligns to 2:293/296 of 2vk2A
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
74% identity, 91% coverage: 29:319/321 of query aligns to 24:315/318 of P39325
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
64% identity, 90% coverage: 31:318/321 of query aligns to 3:289/302 of 5ocpA
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
46% identity, 90% coverage: 29:318/321 of query aligns to 2:290/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
46% identity, 90% coverage: 29:318/321 of query aligns to 2:290/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
46% identity, 90% coverage: 29:318/321 of query aligns to 3:291/305 of 6hbdA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
37% identity, 82% coverage: 50:311/321 of query aligns to 22:274/274 of 2ioyA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
35% identity, 88% coverage: 27:309/321 of query aligns to 7:278/284 of 7e7mC
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
36% identity, 71% coverage: 50:278/321 of query aligns to 23:241/271 of 1dbpA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 76% coverage: 54:298/321 of query aligns to 59:298/349 of A0QYB3
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
35% identity, 76% coverage: 54:298/321 of query aligns to 26:265/315 of 4rs3A
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
35% identity, 76% coverage: 54:298/321 of query aligns to 26:265/314 of 5hkoA
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 71% coverage: 50:278/321 of query aligns to 24:241/270 of 4zjpA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
33% identity, 73% coverage: 42:276/321 of query aligns to 15:248/292 of 2fn8A
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
32% identity, 70% coverage: 31:255/321 of query aligns to 4:220/301 of 2x7xA
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 85% coverage: 4:277/321 of query aligns to 5:280/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
33% identity, 70% coverage: 52:277/321 of query aligns to 25:248/315 of 4rsmA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
31% identity, 65% coverage: 63:270/321 of query aligns to 41:241/287 of 4yo7A
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
28% identity, 84% coverage: 30:298/321 of query aligns to 4:274/288 of 4rxmB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
28% identity, 84% coverage: 30:298/321 of query aligns to 6:276/291 of 4rxmA
Sites not aligning to the query:
>AZOBR_RS31215 FitnessBrowser__azobra:AZOBR_RS31215
MSRTWLISAAAAAALLIGLGGAQAADKKLVVGFSQIGSESGWRAAETKTAKAEAEKRGID
LKISDAQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWDSVLKEAKEAKIPVVLLDRQIE
TRDPGLYMTAVTSDTVLEGRVAGEWLAKQTGGTCNVVELQGTVGSSPAINRKKGFDEVVA
KTPGMKIVRTQSGDFTRAKGKEVMESFIKAENGGKGICAVYAHNDDMAVGAIQAIKEAGL
KPGKDILVVSIDGVPDIFKAMAEGEANATVELTPNMAGPAFDALVAFKKDGKAPPKWIQT
ESALFTPDTAKAEYERRKDAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory