SitesBLAST
Comparing AZOBR_RS31255 FitnessBrowser__azobra:AZOBR_RS31255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
51% identity, 96% coverage: 12:323/325 of query aligns to 5:307/309 of Q53TZ2
- D169 (= D182) mutation to A: Loss of activity.
- N173 (= N186) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
50% identity, 96% coverage: 12:323/325 of query aligns to 2:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K104), H116 (= H132), H150 (= H166), P167 (= P183), N170 (= N186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G20), K11 (= K21), I12 (= I22), S34 (= S44), R35 (≠ P45), H36 (= H46), C64 (= C80), A65 (≠ T81), P66 (= P82), V69 (= V85), E87 (= E103), K88 (= K104), H116 (= H132), Q153 (= Q169), W155 (= W171), D166 (= D182), Y263 (= Y282)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
29% identity, 62% coverage: 3:202/325 of query aligns to 17:234/381 of 1rydA
- active site: K129 (= K104), Y217 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ F19), G40 (= G20), K41 (= K21), Y42 (≠ I22), S64 (= S44), G65 (≠ P45), K69 (vs. gap), Y87 (≠ R62), L106 (≠ T81), P107 (= P82), N108 (≠ P83), L110 (≠ V85), H111 (≠ R86), E128 (= E103), K129 (= K104), R157 (≠ H132), A196 (≠ G168), W199 (= W171), R200 (≠ I172), Y217 (≠ N186)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
29% identity, 62% coverage: 3:202/325 of query aligns to 19:236/383 of 1h6dA
- active site: K131 (= K104), Y219 (≠ N186)
- binding glycerol: K131 (= K104), R202 (≠ I172), D215 (= D182), Y219 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R19 (= R3), G40 (= G18), L41 (≠ F19), G42 (= G20), K43 (= K21), Y44 (≠ I22), S66 (= S44), G67 (≠ P45), K71 (vs. gap), Y89 (≠ R62), I107 (≠ C80), L108 (≠ T81), P109 (= P82), N110 (≠ P83), H113 (≠ R86), E130 (= E103), K131 (= K104), R159 (≠ H132), A198 (≠ G168), W201 (= W171), R202 (≠ I172), Y219 (≠ N186)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
29% identity, 58% coverage: 16:202/325 of query aligns to 7:205/340 of 1evjA
- active site: K100 (= K104), Y188 (≠ N186)
- binding nicotinamide-adenine-dinucleotide: G9 (= G18), L10 (≠ F19), G11 (= G20), K12 (= K21), Y13 (≠ I22), D35 (≠ S44), L77 (≠ T81), P78 (= P82), N79 (≠ P83), H82 (≠ R86), E99 (= E103), K100 (= K104), R128 (≠ H132), W170 (= W171), R171 (≠ I172), Y188 (≠ N186)
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
26% identity, 93% coverage: 12:314/325 of query aligns to 4:308/325 of 1zh8A
- active site: K98 (= K104), H187 (≠ N186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G18), C11 (≠ F19), G12 (= G20), I13 (≠ K21), A14 (≠ I22), S37 (= S44), R38 (≠ P45), T39 (≠ H46), H42 (≠ I49), T74 (≠ C80), L75 (≠ T81), P76 (= P82), L79 (≠ V85), E97 (= E103), K98 (= K104), N126 (≠ H132), Y165 (≠ H166), W170 (= W171), R171 (≠ I172), H187 (≠ N186), Y276 (= Y282)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 3:188/335 of 5a05A
- active site: K100 (= K104), Y185 (≠ N186)
- binding beta-D-glucopyranose: K100 (= K104), F159 (vs. gap), D181 (= D182), Y185 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G18), L10 (≠ F19), G11 (= G20), Y12 (≠ K21), Y13 (≠ I22), S35 (= S44), G36 (vs. gap), T37 (vs. gap), K40 (≠ P45), Y58 (≠ S63), I76 (≠ C80), T77 (= T81), P78 (= P82), N79 (≠ P83), L81 (≠ V85), H82 (≠ R86), E99 (= E103), K100 (= K104), R128 (≠ H132), W167 (= W165), R168 (≠ H166), Y185 (≠ N186)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 3:188/335 of 5a04A
- active site: K100 (= K104), Y185 (≠ N186)
- binding beta-D-glucopyranose: K100 (= K104), F159 (vs. gap), R168 (≠ H166), D181 (= D182), Y185 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ F19), G11 (= G20), Y12 (≠ K21), Y13 (≠ I22), S35 (= S44), G36 (vs. gap), T37 (vs. gap), K40 (≠ P45), Y58 (≠ S63), I76 (≠ C80), T77 (= T81), P78 (= P82), N79 (≠ P83), L81 (≠ V85), H82 (≠ R86), E99 (= E103), K100 (= K104), R128 (≠ H132), W167 (= W165), R168 (≠ H166), Y185 (≠ N186)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 3:188/335 of 5a03E
- active site: K100 (= K104), Y185 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G18), L10 (≠ F19), G11 (= G20), Y12 (≠ K21), Y13 (≠ I22), S35 (= S44), G36 (vs. gap), T37 (vs. gap), K40 (≠ P45), Y58 (≠ S63), I76 (≠ C80), T77 (= T81), P78 (= P82), N79 (≠ P83), H82 (≠ R86), E99 (= E103), K100 (= K104), R128 (≠ H132), W167 (= W165), R168 (≠ H166), Y185 (≠ N186)
- binding beta-D-xylopyranose: K100 (= K104), F159 (vs. gap), R168 (≠ H166), D181 (= D182), Y185 (≠ N186)
- binding alpha-D-xylopyranose: H134 (vs. gap)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 3:188/335 of 5a02A
- active site: K100 (= K104), Y185 (≠ N186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ F19), G11 (= G20), Y12 (≠ K21), Y13 (≠ I22), S35 (= S44), G36 (vs. gap), T37 (vs. gap), K40 (≠ P45), Y58 (≠ S63), I76 (≠ C80), T77 (= T81), P78 (= P82), L81 (≠ V85), H82 (≠ R86), E99 (= E103), K100 (= K104), R128 (≠ H132), W167 (= W165), R168 (≠ H166), Y185 (≠ N186)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 4:189/336 of 5a06A
- active site: K101 (= K104), Y186 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ F19), G12 (= G20), Y13 (≠ K21), Y14 (≠ I22), S36 (= S44), G37 (vs. gap), T38 (vs. gap), K41 (≠ P45), Y59 (≠ S63), I77 (≠ C80), T78 (= T81), P79 (= P82), N80 (≠ P83), L82 (≠ V85), H83 (≠ R86), E100 (= E103), K101 (= K104), R129 (≠ H132), W168 (= W165), R169 (≠ H166), Y186 (≠ N186)
- binding sorbitol: D72 (= D75), H96 (= H99), K101 (= K104), R122 (= R125), R122 (= R125), L124 (= L127), F160 (vs. gap), R169 (≠ H166), D182 (= D182), Y186 (≠ N186)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
31% identity, 55% coverage: 12:189/325 of query aligns to 4:189/336 of 5a03C
- active site: K101 (= K104), Y186 (≠ N186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G18), L11 (≠ F19), G12 (= G20), Y13 (≠ K21), Y14 (≠ I22), S36 (= S44), G37 (vs. gap), T38 (vs. gap), K41 (≠ P45), Y59 (≠ S63), I77 (≠ C80), T78 (= T81), P79 (= P82), N80 (≠ P83), L82 (≠ V85), H83 (≠ R86), E100 (= E103), K101 (= K104), R129 (≠ H132), W168 (= W165), R169 (≠ H166), Y186 (≠ N186)
- binding beta-D-xylopyranose: K101 (= K104), F160 (vs. gap), R169 (≠ H166), D182 (= D182), Y186 (≠ N186)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
35% identity, 41% coverage: 15:147/325 of query aligns to 4:136/332 of 2glxA
- active site: K93 (= K104)
- binding acetate ion: K93 (= K104)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G18), A8 (≠ F19), S9 (≠ G20), T10 (≠ K21), I11 (= I22), S32 (≠ A41), T33 (≠ V42), R37 (≠ H46), S69 (≠ C80), T70 (= T81), N72 (≠ P83), H75 (≠ R86), E92 (= E103), K93 (= K104), H121 (= H132)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
35% identity, 41% coverage: 15:147/325 of query aligns to 5:137/333 of Q2I8V6
- ASTI 9:12 (≠ FGKI 19:22) binding
- S10 (≠ G20) mutation to G: Almost no effect.
- A13 (= A23) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ A41) mutation to D: No activity.
- ST 33:34 (≠ AV 41:42) binding
- R38 (≠ H46) binding
- TTNELH 71:76 (≠ TPPAVR 81:86) binding
- EK 93:94 (= EK 103:104) binding
- K94 (= K104) mutation to G: Less than 1% remaining activity.
- N120 (≠ A130) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
27% identity, 69% coverage: 6:228/325 of query aligns to 2:233/347 of 3q2kC
- active site: K100 (= K104), H188 (≠ A187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ K21), K100 (= K104), W159 (= W158), T160 (≠ K159), R161 (≠ E160), Y165 (vs. gap), N184 (≠ P183), Q185 (≠ G184), H188 (≠ A187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G20), R17 (≠ K21), I18 (= I22), D40 (≠ G47), T41 (≠ A48), A76 (≠ C80), T77 (= T81), S79 (≠ P83), H82 (≠ R86), Q85 (≠ L89), E99 (= E103), K100 (= K104), Q128 (≠ H132), W171 (= W165), R172 (≠ H166)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 243, 244
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
28% identity, 41% coverage: 12:143/325 of query aligns to 4:136/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), G12 (= G20), A13 (≠ K21), Q14 (≠ I22), D36 (≠ S44), S37 (≠ P45), R41 (≠ G47), A73 (≠ C80), G74 (≠ T81), L78 (≠ V85), E96 (= E103), K97 (= K104), N125 (≠ H132)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
25% identity, 52% coverage: 23:190/325 of query aligns to 16:181/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K104), R150 (= R163), W157 (= W165), F160 (≠ G168), D173 (= D182), H177 (≠ N186)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ Q64), Y52 (≠ T65), C67 (= C80), T68 (= T81), P69 (= P82), H73 (≠ R86), E90 (= E103), K91 (= K104), P92 (= P105), Q119 (≠ H132), V159 (≠ P167), F160 (≠ G168), Q166 (≠ A175)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
27% identity, 67% coverage: 12:228/325 of query aligns to 3:228/322 of 3q2kK
- active site: K95 (= K104), H183 (≠ A187)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (≠ K21), K95 (= K104), T155 (≠ K159), R156 (≠ E160), Y160 (vs. gap), N179 (≠ P183), Q180 (≠ G184), H183 (≠ A187)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G18), G11 (= G20), R12 (≠ K21), I13 (= I22), D35 (≠ G47), T36 (≠ A48), T72 (= T81), P73 (= P82), S74 (≠ P83), L76 (≠ V85), H77 (≠ R86), E94 (= E103), K95 (= K104), Q123 (≠ H132), W166 (= W165), R167 (≠ H166), H183 (≠ A187)
Sites not aligning to the query:
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: 239
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
29% identity, 85% coverage: 11:286/325 of query aligns to 1:271/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ K21), F152 (≠ V162), N154 (≠ R164), D175 (= D182), L176 (≠ P183), H179 (≠ N186), E236 (= E244), W271 (≠ Y286)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G20), F11 (≠ K21), M12 (≠ I22), D33 (≠ G47), L34 (≠ A48), T70 (≠ C80), T71 (= T81), P72 (= P82), N73 (≠ P83), L75 (≠ V85), H76 (≠ R86), Q79 (≠ L89), E93 (= E103), K94 (= K104), N122 (≠ H132), W161 (= W171), H179 (≠ N186)
Sites not aligning to the query:
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
29% identity, 85% coverage: 11:286/325 of query aligns to 1:271/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ K21), N154 (≠ R164), D175 (= D182), H179 (≠ N186), E236 (= E244), W271 (≠ Y286)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G18), G10 (= G20), F11 (≠ K21), M12 (≠ I22), D33 (≠ G47), L34 (≠ A48), T70 (≠ C80), T71 (= T81), P72 (= P82), N73 (≠ P83), L75 (≠ V85), H76 (≠ R86), Q79 (≠ L89), E93 (= E103), K94 (= K104), N122 (≠ H132), W161 (= W171)
Sites not aligning to the query:
Query Sequence
>AZOBR_RS31255 FitnessBrowser__azobra:AZOBR_RS31255
MTRPTPLPPAPLTLGIVGFGKIARDQHVPAIAATGLFRLAAVVSPHGAIPEETGLGDVAV
FRSQTEMLAALPGLDAVAICTPPAVRHPLTVEALRAGKHVLIEKPPAATLTELRLLLDAA
EGAKRTLFAAWHSRFNAAVEETRRRLAGATVRNVAITWKEDVRRWHPGQDWIFAAGGFGV
FDPGINALSILTEILPAPVVVRDAELRVPANRDTPIAATLRMEGAAGSAVGTVTAAFDFL
QEGEQTWAIAIETDSGGLDLTHGGTRLSVDGVLVLAKPDAEYQGIYRRFHHLIADAAGDV
DARPLQLVADACLVGRWRTTDAFHW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory