Comparing AZOBR_RS31445 FitnessBrowser__azobra:AZOBR_RS31445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
28% identity, 88% coverage: 33:316/323 of query aligns to 5:288/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
27% identity, 88% coverage: 33:316/323 of query aligns to 5:288/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
27% identity, 88% coverage: 33:316/323 of query aligns to 5:288/294 of 7ndsA
2dvzA Structure of a periplasmic transporter (see paper)
25% identity, 63% coverage: 117:321/323 of query aligns to 94:297/300 of 2dvzA
Sites not aligning to the query:
5okuA R. Palustris rpa4515 with adipate (see paper)
22% identity, 77% coverage: 31:280/323 of query aligns to 5:255/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
22% identity, 77% coverage: 31:280/323 of query aligns to 5:255/299 of 5oeiA
2f5xB Structure of periplasmic binding protein bugd (see paper)
25% identity, 76% coverage: 31:276/323 of query aligns to 5:247/300 of 2f5xB
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
24% identity, 67% coverage: 42:258/323 of query aligns to 15:232/296 of 6hkeB
Sites not aligning to the query:
>AZOBR_RS31445 FitnessBrowser__azobra:AZOBR_RS31445
MSLGNPAKGMLAAAVLAAAALFAAPASAEIKNLEIIAPANAGGGYDQHARAMQQVLQEHK
LASSVQVVNIPGAGGTIGLSQFVTAKKRNPGLMISGLGMIGAILINKSPVSLDQVTPLAR
LTGEYQPIVVAADSPLKTLDDLVKKFKADPGSVSWGGFAVGSPDHILYGLLVKAIGGDVS
KMNYIAAGAGGEMMASVLGGHITVATGGYNEMASQLQAGKLRALAISAPQRLPGIDVPTF
KEQGVDVELVNWRAVMAPGNLKASEKQVLDDAVGAMVRTDEWKRIAEERGWIDLYLPPDR
FAAFVKDERTRIEGVLMELGLVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory