SitesBLAST
Comparing AZOBR_RS31940 FitnessBrowser__azobra:AZOBR_RS31940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
68% identity, 99% coverage: 2:554/561 of query aligns to 8:556/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C102), T112 (≠ S106), C113 (= C107), C141 (= C135), L144 (≠ A138), C145 (= C139)
- binding flavin mononucleotide: G221 (= G215), G223 (= G217), K232 (= K226), N248 (= N242), D250 (= D244), Y324 (= Y322), G327 (= G325), E328 (= E326), N363 (= N361), N364 (= N362), T367 (= T365)
- binding iron/sulfur cluster: I325 (= I323), P343 (= P341), S496 (= S494), C497 (= C495), G498 (= G496), Q499 (= Q497), C500 (= C498), C503 (= C501), I536 (= I534), C537 (= C535), L539 (= L537), G540 (= G538)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
41% identity, 68% coverage: 178:561/561 of query aligns to 164:560/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G217), N227 (= N242), E230 (= E245), N355 (= N362), G535 (= G536), L536 (= L537)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E327), R337 (≠ K344), R340 (≠ F347), T341 (≠ P348), N342 (≠ S349), S433 (= S440)
- binding iron/sulfur cluster: S487 (= S494), C488 (= C495), G489 (= G496), C491 (= C498), C494 (= C501), C534 (= C535), L536 (= L537), G537 (= G538)
- binding zinc ion: C471 (≠ D478), H558 (≠ E559)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
37% identity, 82% coverage: 97:555/561 of query aligns to 26:540/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C102), G33 (≠ S104), T34 (≠ L105), C36 (= C107), C67 (= C135), C68 (≠ M136), G69 (= G137), R70 (≠ A138), C71 (= C139)
- binding flavin mononucleotide: G185 (= G215), R186 (≠ L216), G187 (= G217), N213 (= N242), D215 (= D244), E216 (= E245), G217 (= G246), F301 (≠ Y322), G304 (= G325), E305 (= E326), E306 (= E327), N340 (= N361), N341 (= N362), G521 (= G536), L522 (= L537)
- binding iron/sulfur cluster: P320 (= P341), S473 (= S494), C474 (= C495), G475 (= G496), K476 (≠ Q497), C477 (= C498), C480 (= C501), L519 (≠ I534), C520 (= C535), L522 (= L537), G523 (= G538)
- binding zinc ion: C457 (≠ D478)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 68% coverage: 178:561/561 of query aligns to 18:415/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D478), C364 (vs. gap), H413 (≠ E559)
- binding flavin mononucleotide: G54 (= G215), G56 (= G217), K65 (= K226), N82 (= N242), D84 (= D244), E85 (= E245), G173 (= G325), E175 (= E327), N210 (= N362), G390 (= G536), L391 (= L537)
- binding nicotinamide-adenine-dinucleotide: G56 (= G217), G57 (= G218), A58 (= A219), F60 (= F221), K65 (= K226), F68 (= F229), E85 (= E245), E175 (= E327), R192 (≠ K344), F195 (= F347), I312 (≠ F464), M313 (≠ I465), S315 (= S467)
- binding iron/sulfur cluster: S342 (= S494), C343 (= C495), G344 (= G496), C346 (= C498), C349 (= C501), S387 (= S533), C389 (= C535), L391 (= L537), G392 (= G538)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 68% coverage: 178:561/561 of query aligns to 18:415/425 of 7t2rB
Sites not aligning to the query:
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
34% identity, 83% coverage: 99:561/561 of query aligns to 8:529/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C102), C16 (= C107), C48 (= C135), F49 (≠ M136), L51 (≠ A138), C52 (= C139)
- binding flavin mononucleotide: G166 (= G215), G168 (= G217), N196 (= N242), D198 (= D244), F284 (≠ Y322), G287 (= G325), E288 (= E326), E289 (= E327), N324 (= N362)
- binding iron/sulfur cluster: C457 (= C495), G458 (= G496), K459 (≠ Q497), C460 (= C498), C463 (= C501), C503 (= C535), G506 (= G538)
- binding zinc ion: C440 (≠ D478), H527 (≠ E559)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
40% identity, 68% coverage: 178:561/561 of query aligns to 1:400/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G215), G39 (= G217), N67 (= N242), G158 (= G325), E159 (= E326), E160 (= E327), G375 (= G536)
- binding nicotinamide-adenine-dinucleotide: G40 (= G218), F43 (= F221), K48 (= K226), R177 (≠ K344), F180 (= F347), M297 (≠ F464)
- binding iron/sulfur cluster: S327 (= S494), C328 (= C495), G329 (= G496), K330 (≠ Q497), C331 (= C498), C334 (= C501), L373 (≠ I534), C374 (= C535)
- binding zinc ion: C311 (≠ D478), H398 (≠ E559)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 404, 409
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
39% identity, 68% coverage: 174:555/561 of query aligns to 25:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G215), G66 (= G217), K75 (= K226), N91 (= N242), D93 (= D244), E94 (= E245), Y179 (= Y322), G182 (= G325), E183 (= E326), N218 (= N361), N219 (= N362), T222 (= T365)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G217), G67 (= G218), A68 (= A219), F70 (= F221), K75 (= K226), E94 (= E245), E96 (= E247), T99 (= T250), E184 (= E327), Y204 (≠ F347), T318 (≠ S467)
- binding iron/sulfur cluster: P198 (= P341), T345 (≠ S494), C346 (= C495), G347 (= G496), Q348 (= Q497), C349 (= C498), C352 (= C501), I391 (= I534), C392 (= C535), G395 (= G538)
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
40% identity, 64% coverage: 203:561/561 of query aligns to 2:377/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G215), G16 (= G217), N44 (= N242), G135 (= G325), E137 (= E327), N171 (= N361), N172 (= N362), G352 (= G536)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G217), G17 (= G218), F20 (= F221), K25 (= K226), F28 (= F229), D49 (≠ E247), R154 (≠ K344), F157 (= F347), S250 (= S440)
- binding iron/sulfur cluster: P151 (= P341), C305 (= C495), G306 (= G496), K307 (≠ Q497), C308 (= C498), C311 (= C501), C351 (= C535), G354 (= G538)
- binding zinc ion: C288 (≠ D478), H375 (≠ E559)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 381, 386
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
39% identity, 68% coverage: 174:555/561 of query aligns to 26:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G215), G67 (= G217), K76 (= K226), N92 (= N242), E95 (= E245), Y180 (= Y322), G183 (= G325), E184 (= E326), V218 (≠ I360), N219 (= N361), N220 (= N362), T223 (= T365)
- binding iron/sulfur cluster: T346 (≠ S494), C347 (= C495), G348 (= G496), Q349 (= Q497), C350 (= C498), C353 (= C501), S391 (= S533), I392 (= I534), C393 (= C535), G396 (= G538)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
39% identity, 68% coverage: 174:555/561 of query aligns to 25:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G215), G66 (= G217), K75 (= K226), N91 (= N242), D93 (= D244), E94 (= E245), G182 (= G325), E183 (= E326), E184 (= E327), V217 (≠ I360), N218 (= N361), N219 (= N362), T222 (= T365), G393 (= G536)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G217), G67 (= G218), A68 (= A219), F70 (= F221), K75 (= K226), E94 (= E245), E96 (= E247), Y179 (= Y322), E184 (= E327), Y204 (≠ F347)
- binding iron/sulfur cluster: P198 (= P341), T345 (≠ S494), C346 (= C495), G347 (= G496), Q348 (= Q497), C349 (= C498), C352 (= C501), I391 (= I534), C392 (= C535), L394 (= L537), G395 (= G538)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
39% identity, 68% coverage: 174:555/561 of query aligns to 24:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G215), G65 (= G217), K74 (= K226), N90 (= N242), D92 (= D244), E93 (= E245), G181 (= G325), E182 (= E326), E183 (= E327), V216 (≠ I360), N217 (= N361), N218 (= N362), T221 (= T365)
- binding nicotinamide-adenine-dinucleotide: G65 (= G217), G66 (= G218), A67 (= A219), F69 (= F221), K74 (= K226), E95 (= E247), Y178 (= Y322), E183 (= E327), K200 (= K344), Y203 (≠ F347)
- binding iron/sulfur cluster: I179 (= I323), P197 (= P341), T344 (≠ S494), C345 (= C495), G346 (= G496), Q347 (= Q497), C348 (= C498), C351 (= C501), S389 (= S533), I390 (= I534), C391 (= C535), L393 (= L537), G394 (= G538)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
40% identity, 67% coverage: 178:555/561 of query aligns to 28:420/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
40% identity, 67% coverage: 178:555/561 of query aligns to 27:419/437 of 4hea1
- binding flavin mononucleotide: G63 (= G215), K74 (= K226), N91 (= N242), D93 (= D244), Y179 (= Y322), G182 (= G325), E183 (= E326), N218 (= N361), N219 (= N362), L401 (= L537)
- binding iron/sulfur cluster: I180 (= I323), P198 (= P341), S351 (= S494), C352 (= C495), G353 (= G496), K354 (≠ Q497), C355 (= C498), C358 (= C501), F398 (≠ I534), C399 (= C535), L401 (= L537)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
40% identity, 67% coverage: 178:555/561 of query aligns to 27:419/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G215), G65 (= G217), N91 (= N242), D93 (= D244), G182 (= G325), E183 (= E326), E184 (= E327), N218 (= N361), N219 (= N362), T222 (= T365), P400 (≠ G536)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G217), G66 (= G218), F69 (= F221), K74 (= K226), F77 (= F229), E96 (= E247), Y179 (= Y322), E184 (= E327), K201 (= K344), F204 (= F347), T324 (≠ S467)
- binding iron/sulfur cluster: S351 (= S494), C352 (= C495), K354 (≠ Q497), C355 (= C498), C358 (= C501), F398 (≠ I534), C399 (= C535), L401 (= L537), A402 (≠ G538)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
38% identity, 71% coverage: 164:561/561 of query aligns to 5:424/442 of 7p61F
- binding flavin mononucleotide: G61 (= G215), G63 (= G217), K72 (= K226), N90 (= N242), D92 (= D244), G181 (= G325), E182 (= E326), N217 (= N361), N218 (= N362), A399 (≠ G536), H400 (≠ L537)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G217), G64 (= G218), A65 (= A219), F67 (= F221), K72 (= K226), L75 (≠ F229), E95 (= E247), Y178 (= Y322), E183 (= E327), F203 (= F347), R320 (≠ F464), T323 (≠ S467)
- binding iron/sulfur cluster: S350 (= S494), C351 (= C495), W353 (≠ Q497), C354 (= C498), C357 (= C501), F397 (≠ I534), C398 (= C535), H400 (≠ L537)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
40% identity, 64% coverage: 204:561/561 of query aligns to 46:424/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G215), G59 (= G217), K68 (= K226), N89 (= N242), D91 (= D244), E92 (= E245), G180 (= G325), E181 (= E326), E182 (= E327), T216 (≠ N361), N217 (= N362)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G217), G60 (= G218), F63 (= F221), K68 (= K226), E94 (= E247), Y177 (= Y322), E182 (= E327), F202 (= F347), T324 (≠ S467)
- binding iron/sulfur cluster: P196 (= P341), S351 (= S494), C352 (= C495), G353 (= G496), Q354 (= Q497), C355 (= C498), C358 (= C501), T396 (≠ S533), C398 (= C535), L400 (= L537)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
40% identity, 64% coverage: 204:561/561 of query aligns to 47:425/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G217), K69 (= K226), N90 (= N242), D92 (= D244), E93 (= E245), G94 (= G246), Y178 (= Y322), G181 (= G325), E182 (= E326), N218 (= N362)
- binding iron/sulfur cluster: P197 (= P341), S352 (= S494), C353 (= C495), Q355 (= Q497), C356 (= C498), C359 (= C501), T397 (≠ S533), C399 (= C535)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
39% identity, 64% coverage: 202:561/561 of query aligns to 46:426/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G215), G61 (= G217), K70 (= K226), N91 (= N242), D93 (= D244), G182 (= G325), E183 (= E326), E184 (= E327), A218 (≠ N361), N219 (= N362), A401 (≠ G536), L402 (= L537)
- binding iron/sulfur cluster: P198 (= P341), C354 (= C495), G355 (= G496), Q356 (= Q497), C357 (= C498), C360 (= C501), T398 (≠ S533), C400 (= C535), L402 (= L537)
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
40% identity, 63% coverage: 202:556/561 of query aligns to 56:428/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G215), G71 (= G217), K80 (= K226), N98 (= N242), D100 (= D244), G189 (= G325), E191 (= E327), N226 (= N362), A408 (≠ G536), L409 (= L537)
- binding iron/sulfur cluster: P205 (= P341), C361 (= C495), G362 (= G496), Q363 (= Q497), C364 (= C498), C367 (= C501), T405 (≠ S533), C407 (= C535), L409 (= L537)
Query Sequence
>AZOBR_RS31940 FitnessBrowser__azobra:AZOBR_RS31940
IHPGSGRRNTRPQPKGRQVDPAALAEVQELLGDRSRQRDLLIEHLHLLQDTYHGLHARHL
AALAHEMRLALVEVYEVASFYAHFDIVMDGEEAPPPVTVRVCDSLSCCMAGGEKLLDELK
AADMGPDVRVVRAPCMGACHNAPAVAIGHALHENATVESVVTAVKNGETHPQLPTYVSLE
QYKAEGGYRLLADCLTGNVPVDDILGKLEGANLRGLGGAGFPTGRKWRFVRHEPGPRLMA
VNGDEGEPGTFKDRYYLENDPHRFLEGMLIGAWVVEATDVYIYLRDEYPHIREVLEHEIA
AVEKAGLAGHTRIHLRRGAGAYICGEESAMLESIEGKRGLPRHKPPFPSVVGLFGRPTLI
NNVETLFWIRDILEKGADWWGSHGRNGRKGLRSYSVSGHVKDPGVKLAPAGVTIRELIDE
YCGGMADGHTLKGYLPGGASGGILPASMDDIPLDFGTLEQHGCFIGSAAVVVLSDQDDMR
KVVRNLLDFFEDESCGQCTPCRVGTEKAVALIKQPVWDEPLLTELARLMGTASICGLGQA
AMNPLKSALKHFRDDLRGEVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory