Comparing AZOBR_RS32405 AZOBR_RS32405 ABC transporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 96% coverage: 5:249/255 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 96% coverage: 5:249/255 of query aligns to 4:253/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 91% coverage: 5:237/255 of query aligns to 2:223/241 of 4u00A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 96% coverage: 6:249/255 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 96% coverage: 6:249/255 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 96% coverage: 6:249/255 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 96% coverage: 6:249/255 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 95% coverage: 6:248/255 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 95% coverage: 6:248/255 of query aligns to 3:234/234 of 4p31A
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 98% coverage: 1:250/255 of query aligns to 2:239/240 of 1ji0A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 95% coverage: 6:247/255 of query aligns to 3:233/233 of 6b8bA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 91% coverage: 5:237/255 of query aligns to 1:223/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 94% coverage: 5:244/255 of query aligns to 17:242/378 of P69874
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 96% coverage: 5:249/255 of query aligns to 4:239/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 91% coverage: 5:235/255 of query aligns to 3:223/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 91% coverage: 5:235/255 of query aligns to 3:223/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 91% coverage: 5:235/255 of query aligns to 3:223/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 91% coverage: 5:235/255 of query aligns to 3:223/242 of 2oljA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 83% coverage: 20:231/255 of query aligns to 19:220/225 of 8iddA
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
34% identity, 83% coverage: 20:231/255 of query aligns to 19:220/227 of 8igqA
Sites not aligning to the query:
>AZOBR_RS32405 AZOBR_RS32405 ABC transporter
MSNTLLSIQGLTRRFGGLLAVSDVSATIAKGELVGLIGPNGAGKTTLFNLITGFTPPSDG
TVTFDGQDVTGRKPWQIARMGMGRTFQNLRVFPNMTVFDNVSVGAVGAFGQSPWRALING
GAHSRAVSERSWEALERVGLTAQAGDIAANLSYGKRKYLEIARALATAPRLLILDEPAAG
LNDTETAELADFIRRLHAGGVTVLLVEHDMGLVMGSCSRVIVLASGRKIADGTPEAVQRD
PAVLEAYLGVEDDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory