Comparing AZOBR_RS32455 FitnessBrowser__azobra:AZOBR_RS32455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
37% identity, 86% coverage: 12:297/332 of query aligns to 2:278/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
37% identity, 86% coverage: 14:297/332 of query aligns to 2:276/285 of 3uf6A
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 58% coverage: 94:287/332 of query aligns to 499:691/714 of Q8ZND6
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
24% identity, 74% coverage: 39:285/332 of query aligns to 456:735/759 of P76558
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
28% identity, 48% coverage: 130:287/332 of query aligns to 161:316/339 of 6ioxA
Sites not aligning to the query:
>AZOBR_RS32455 FitnessBrowser__azobra:AZOBR_RS32455
MARTLETTAAGCPARLMARSAALEPVPTAVVAAGSPVALESARRATALGLIEPVLVGDPT
AIADSARRIGWTLHGACVVPARDDAAAARIAVALARSGDVGALMKGHIHTDTLMLAALHP
KNGLRTGRRFTHAFHMTLPGSGRELVITDAAINVAPSLNTRLDIIRNAVELWRLVGGSDP
RVALLSCTEEVTERVPSSMDADRLTRLCQQEVPGATVFGPLALDLAVSAEAARIKNLTHP
CAGAADILVVPNIETGNALFKALVHFLDAVAAGVVLGAAVPIVLTSRADPPAARIAAAAI
AQIVAGRRRSATPGAPYPTTAAKGGAAPGLHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory