Comparing AZOBR_RS33525 FitnessBrowser__azobra:AZOBR_RS33525 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
62% identity, 99% coverage: 4:371/373 of query aligns to 3:365/366 of 3dmeA
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
29% identity, 92% coverage: 28:371/373 of query aligns to 29:405/412 of 8w7fB
Sites not aligning to the query:
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
29% identity, 92% coverage: 28:371/373 of query aligns to 29:403/410 of 8w78A
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
29% identity, 99% coverage: 1:371/373 of query aligns to 1:364/384 of 4x9mA
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
29% identity, 99% coverage: 1:371/373 of query aligns to 1:364/384 of P75063
>AZOBR_RS33525 FitnessBrowser__azobra:AZOBR_RS33525
MERVDCVVAGAGVIGLAVAWRLARAGREVVVLEAADAIGTGTSSRNSEVIHAGIYYPTGS
LRARLCVAGRDALYAYCAQHGVEHKRIGKLIVATEEAQLPRLEAIRAQAVANGVDDLAAL
SATEARALEPALRCVGALLSPSTGIIDSHGLMLALQGDAEAAGAMLAFLSPLEHTHRRAD
GFELEVGGAEPTRIACDTLVNAAGLGAWGGARGLEGFPAEHVPPRVLAKGNYYALGQGRA
PFARLVYPVPVEGGLGVHLTLDLAGQARFGPDVEWLDPADHDRLDYRVDPRRADGFYGEV
RRYWPDLPDGALVPAYSGVRPKLSGPGQPQADFLIQGPEVHGVPGLVNLFGMESPGLTSC
LAIADEVAARLGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory