SitesBLAST
Comparing AZOBR_RS33705 FitnessBrowser__azobra:AZOBR_RS33705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 7:333/333 of O25511
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 3:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K88), S176 (= S177), V177 (= V178), T195 (= T196), M199 (= M200), R201 (= R202), M235 (≠ I236), R254 (= R255), E257 (= E258)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ S13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S37), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D64), V64 (= V65), A83 (= A84), A84 (= A85), A85 (= A86), K87 (= K88), L125 (= L126), S126 (= S127), Y137 (= Y138), K141 (= K142), Y167 (= Y168), G168 (= G169), V170 (= V171)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 3:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ S13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D64), V64 (= V65), A83 (= A84), A84 (= A85), A85 (= A86), K87 (= K88), L125 (= L126), S126 (= S127), K141 (= K142), Y167 (= Y168), G168 (= G169), V170 (= V171), R174 (= R175)
- binding uridine-5'-diphosphate-glucose: K87 (= K88), T127 (= T128), K129 (= K130), Y137 (= Y138), N169 (= N170), S176 (= S177), V177 (= V178), P193 (= P194), T195 (= T196), M199 (= M200), R201 (= R202), M235 (≠ I236), R254 (= R255), E257 (= E258)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 3:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ S13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D64), V64 (= V65), A84 (= A85), A85 (= A86), K87 (= K88), S126 (= S127), Y137 (= Y138), K141 (= K142), Y167 (= Y168), G168 (= G169), V170 (= V171), S173 (= S174), R174 (= R175)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K88), D128 (= D129), K129 (= K130), N169 (= N170), G175 (= G176), S176 (= S177), V177 (= V178), P193 (= P194), I194 (≠ V195), M199 (= M200), R201 (= R202), M235 (≠ I236), R254 (= R255), E257 (= E258)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 3:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (≠ S13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S37), R40 (= R38), D41 (= D39), K44 (= K42), D63 (= D64), V64 (= V65), A83 (= A84), A84 (= A85), A85 (= A86), K87 (= K88), T102 (= T103), L125 (= L126), S126 (= S127), T127 (= T128), Y137 (= Y138), K141 (= K142), Y167 (= Y168), G168 (= G169), V170 (= V171), S173 (= S174), R174 (= R175)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K88), T127 (= T128), D128 (= D129), K129 (= K130), Y137 (= Y138), N169 (= N170), S176 (= S177), V177 (= V178), P193 (= P194), T195 (= T196), M199 (= M200), R201 (= R202), M235 (≠ I236), R254 (= R255), E257 (= E258)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
58% identity, 99% coverage: 1:326/330 of query aligns to 1:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (≠ S13), G14 (= G14), S15 (= S15), F16 (= F16), S37 (= S37), R38 (= R38), D39 (= D39), K42 (= K42), D61 (= D64), V62 (= V65), A81 (= A84), A82 (= A85), A83 (= A86), K85 (= K88), T100 (= T103), L123 (= L126), S124 (= S127), K139 (= K142), Y165 (= Y168), G166 (= G169), V168 (= V171), S171 (= S174), R172 (= R175)
- binding uridine-5'-diphosphate: K127 (= K130), N167 (= N170), V175 (= V178), P191 (= P194), I192 (≠ V195), T193 (= T196), M197 (= M200), R199 (= R202), M233 (≠ I236), R252 (= R255)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
39% identity, 84% coverage: 5:282/330 of query aligns to 6:289/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (≠ S13), G15 (= G14), T16 (≠ S15), I17 (≠ F16), S37 (= S37), R38 (= R38), S39 (≠ D39), D63 (= D64), I64 (≠ V65), V83 (≠ A84), A84 (= A85), K87 (= K88), T125 (≠ L126), S127 (≠ T128), Y137 (= Y138), K141 (= K142), F167 (≠ Y168), V170 (= V171), S173 (= S174), R174 (= R175)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K88), H88 (= H89), S127 (≠ T128), N128 (≠ D129), Y137 (= Y138), N169 (= N170), S176 (= S177), V177 (= V178), L180 (= L181), T192 (≠ P194), T194 (= T196), M198 (= M200), R200 (= R202), L234 (≠ I236), E265 (= E258)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
40% identity, 93% coverage: 7:312/330 of query aligns to 16:320/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K88), Q94 (≠ H89), N175 (= N170), S179 (= S174), R180 (= R175), S182 (= S177), V183 (= V178), L186 (= L181), T198 (≠ P194), I199 (≠ V195), T200 (= T196), M204 (= M200), R206 (= R202), V240 (≠ I236), R263 (= R255), E266 (= E258)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
40% identity, 93% coverage: 7:312/330 of query aligns to 16:320/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), T22 (≠ S13), G23 (= G14), S24 (= S15), F25 (= F16), S45 (= S37), R46 (= R38), D47 (= D39), K50 (= K42), D69 (= D64), V70 (= V65), A89 (= A84), A90 (= A85), A91 (= A86), K93 (= K88), L131 (= L126), T133 (= T128), K147 (= K142), Y173 (= Y168)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H89), V95 (= V90), K135 (= K130), N175 (= N170), S182 (= S177), V183 (= V178), L186 (= L181), T198 (≠ P194), T200 (= T196), M204 (= M200), V240 (≠ I236), R263 (= R255), E266 (= E258), Y278 (≠ S270), S313 (≠ G305), Y314 (≠ F306), E315 (≠ R307), Y316 (= Y308), N320 (≠ T312)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
42% identity, 88% coverage: 1:291/330 of query aligns to 1:291/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (≠ S13), G14 (= G14), S15 (= S15), F16 (= F16), S36 (= S37), R37 (= R38), D38 (= D39), K41 (= K42), D60 (= D64), V61 (= V65), A80 (= A84), A81 (= A85), A82 (= A86), K84 (= K88), T99 (= T103), L122 (= L126), K138 (= K142), Y164 (= Y168)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
40% identity, 87% coverage: 2:288/330 of query aligns to 3:288/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (≠ S13), G15 (= G14), F17 (= F16), S37 (= S37), R38 (= R38), D39 (= D39), K42 (= K42), D61 (= D64), V62 (= V65), R63 (= R66), A81 (= A84), A82 (= A85), A83 (= A86), K85 (= K88), S124 (= S127), T125 (= T128), K139 (= K142), Y165 (= Y168), G166 (= G169)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
35% identity, 87% coverage: 2:288/330 of query aligns to 1:241/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), T12 (≠ S13), G13 (= G14), S14 (= S15), F15 (= F16), S35 (= S37), R36 (= R38), D37 (= D39), K40 (= K42), D59 (= D64), V60 (= V65), A80 (= A85), A81 (= A86), K83 (= K88), L121 (= L126), T123 (= T128), K137 (= K142), Y163 (= Y168), G164 (= G169)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
30% identity, 92% coverage: 2:306/330 of query aligns to 3:294/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), G15 (= G14), S16 (= S15), L17 (≠ F16), R36 (= R38), D37 (= D39), D59 (= D64), I60 (≠ V65), A81 (= A84), A82 (= A85), A83 (= A86), K85 (= K88), V128 (≠ L126), Y140 (= Y138), K144 (= K142), Y168 (= Y168), G169 (= G169), V171 (= V171)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
29% identity, 83% coverage: 2:275/330 of query aligns to 22:297/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S37), H57 (≠ R38), S82 (≠ D64), I83 (≠ V65), A104 (= A84), A105 (= A85), A106 (= A86), K108 (= K88), N123 (≠ T103), I146 (≠ L126), K162 (= K142), F184 (≠ Y168), G185 (= G169), N186 (= N170), V187 (= V171), S190 (= S174), S191 (≠ R175)
- binding uridine-5'-diphosphate: K150 (= K130), N186 (= N170), S193 (= S177), V194 (= V178), T209 (≠ P194), L210 (≠ V195), T211 (= T196), I215 (≠ M200), R217 (= R202), E279 (= E258)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
28% identity, 83% coverage: 2:275/330 of query aligns to 22:297/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S37), H57 (≠ R38), S82 (≠ D64), I83 (≠ V65), A104 (= A84), A105 (= A85), A106 (= A86), K108 (= K88), N123 (≠ T103), I146 (≠ L126), K162 (= K142), F184 (≠ Y168), G185 (= G169), N186 (= N170), V187 (= V171), S190 (= S174), S191 (≠ R175)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K88), H109 (= H89), T148 (= T128), G185 (= G169), N186 (= N170), S193 (= S177), V194 (= V178), T209 (≠ P194), L210 (≠ V195), T211 (= T196), I215 (≠ M200), R217 (= R202), R276 (= R255), E279 (= E258)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
25% identity, 80% coverage: 8:272/330 of query aligns to 34:291/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G14), S41 (= S15), I42 (≠ F16), D62 (≠ S37), I63 (≠ R38), D92 (≠ F61), I93 (= I62), L114 (≠ A84), S115 (≠ A85), A116 (= A86), K118 (= K88), V158 (≠ L126), D161 (= D129), K174 (= K142), V198 (= V171), S201 (= S174)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
30% identity, 67% coverage: 7:227/330 of query aligns to 3:240/322 of 1r66A
- active site: T127 (= T128), D128 (= D129), E129 (≠ K130), Y151 (= Y138), K155 (= K142)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (= D39), S38 (≠ E40), L39 (≠ F41), T40 (≠ K42), G43 (≠ E45), D63 (= D64), I64 (≠ V65), F83 (≠ A84), A84 (= A85), A85 (= A86), S87 (≠ K88), T102 (= T103), V125 (≠ L126), S126 (= S127), Y151 (= Y138), K155 (= K142), N181 (≠ V171)
- binding thymidine-5'-diphosphate: H88 (= H89), E129 (≠ K130), N180 (= N170), K190 (≠ S177), L191 (≠ V178), P206 (= P194), Y208 (≠ T196), R215 (= R202)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
30% identity, 67% coverage: 7:227/330 of query aligns to 3:240/322 of 1r6dA
- active site: T127 (= T128), N128 (≠ D129), Q129 (≠ K130), Y151 (= Y138), K155 (= K142)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K88), H88 (= H89), T127 (= T128), N128 (≠ D129), Q129 (≠ K130), Y151 (= Y138), N180 (= N170), K190 (≠ S177), L191 (≠ V178), P206 (= P194), Y208 (≠ T196), R215 (= R202)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (= D39), S38 (≠ E40), L39 (≠ F41), T40 (≠ K42), A42 (≠ Y44), G43 (≠ E45), D63 (= D64), I64 (≠ V65), F83 (≠ A84), A84 (= A85), A85 (= A86), S87 (≠ K88), T102 (= T103), V125 (≠ L126), S126 (= S127), Y151 (= Y138), K155 (= K142), N181 (≠ V171)
Sites not aligning to the query:
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
25% identity, 68% coverage: 8:230/330 of query aligns to 32:239/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G14), S39 (= S15), I40 (≠ F16), D60 (≠ S37), I61 (≠ R38), L89 (≠ F60), D90 (≠ F61), I91 (= I62), L112 (≠ A84), S113 (≠ A85), A114 (= A86), K116 (= K88), D159 (= D129), K172 (= K142), N195 (= N170), V196 (= V171), S199 (= S174)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 59% coverage: 5:198/330 of query aligns to 9:220/667 of Q9LPG6
- G18 (= G14) mutation to A: Abolishes dehydratase activity.
- K36 (≠ R32) mutation to A: Reduces dehydratase activity.
- D96 (≠ P91) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K142) mutation to A: Abolishes dehydratase activity.
- G193 (= G173) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Query Sequence
>AZOBR_RS33705 FitnessBrowser__azobra:AZOBR_RS33705
MLNGQSILVTGGSGSFGKRFVETVLRHASPRRVIVFSRDEFKQYEMQQQLGPDWASTLRF
FIGDVRDRERLELAMREVDVCVHAAALKHVPAAEYNPMECIHTNVYGAENVVRAALNTGV
KRVIALSTDKAANPVNLYGASKLASDKIFIAANNLSGSLGTRFSVVRYGNVVGSRGSVIP
LFRRMIAEGAESLPVTDDRMTRFWITLQHGVDFVVSCIAMMQGGEIFVPKIPSMRITDLA
RAMAPHLPHKQVGIRPGEKLHEVMITEDDSRQTFELPDRFVIEPAFAFWTHEPYQRLGAK
PVADGFRYASDTNGDWLDGARLMRLLAEAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory