SitesBLAST
Comparing Ac3H11_1015 Aromatic-amino-acid aminotransferase (EC 2.6.1.57) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
43% identity, 99% coverage: 3:396/396 of query aligns to 10:390/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I15), R23 (= R16), G39 (= G32), G40 (= G33), G99 (= G98), S100 (= S99), Q101 (= Q100), Y125 (≠ F124), N174 (= N173), D202 (= D201), Y205 (= Y204), S235 (= S236), S237 (= S238), K238 (= K239), R245 (= R246), R368 (= R374)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
43% identity, 99% coverage: 3:396/396 of query aligns to 10:390/397 of Q72LL6
- S20 (= S13) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R16) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G33) binding
- Y70 (= Y63) binding
- N174 (= N173) binding ; binding
- R245 (= R246) binding
- R368 (= R374) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
43% identity, 99% coverage: 3:396/396 of query aligns to 6:386/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I15), R19 (= R16), G35 (= G32), G36 (= G33), G95 (= G98), S96 (= S99), Q97 (= Q100), Y121 (≠ F124), N170 (= N173), D198 (= D201), Y201 (= Y204), S231 (= S236), S233 (= S238), K234 (= K239), R241 (= R246), R364 (= R374)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
43% identity, 99% coverage: 3:396/396 of query aligns to 6:386/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G98), S96 (= S99), Q97 (= Q100), Y121 (≠ F124), N170 (= N173), D198 (= D201), A200 (≠ P203), Y201 (= Y204), S231 (= S236), S233 (= S238), K234 (= K239), R241 (= R246)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
37% identity, 99% coverage: 3:396/396 of query aligns to 10:398/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R16), G40 (= G33), L41 (≠ F34)
- binding 2-oxoglutaric acid: D213 (= D202), P214 (= P203), Y215 (= Y204), G216 (= G205), E217 (≠ D206), G241 (= G235), T242 (≠ S236), I246 (≠ V240)
- binding (2E)-pent-2-enedioic acid: G40 (= G33), Y130 (≠ F124), N184 (= N173), R376 (= R374)
- binding glutamic acid: S20 (= S13), V22 (≠ I15), L131 (= L125), V360 (= V358), A364 (≠ P362), R369 (≠ N367)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G98), S105 (= S99), Q106 (= Q100), Y130 (≠ F124), N184 (= N173), D212 (= D201), P214 (= P203), Y215 (= Y204), T242 (≠ S236), S244 (= S238), K245 (= K239), R252 (= R246)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
37% identity, 99% coverage: 3:396/396 of query aligns to 10:398/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S13), V22 (≠ I15), R23 (= R16), L131 (= L125), Q135 (= Q129), A364 (≠ P362), R369 (≠ N367)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R16), G40 (= G33), Y130 (≠ F124), L131 (= L125), A132 (= A126), N184 (= N173), R376 (= R374)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G98), S105 (= S99), Q106 (= Q100), Y130 (≠ F124), V179 (≠ I168), N184 (= N173), D212 (= D201), P214 (= P203), Y215 (= Y204), T242 (≠ S236), S244 (= S238), K245 (= K239), R252 (= R246)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
37% identity, 99% coverage: 3:396/396 of query aligns to 10:398/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R16), Y70 (= Y63), Y130 (≠ F124), L275 (≠ A269)
- binding pyridoxal-5'-phosphate: G104 (= G98), S105 (= S99), Q106 (= Q100), Y130 (≠ F124), V179 (≠ I168), N184 (= N173), D212 (= D201), P214 (= P203), Y215 (= Y204), T242 (≠ S236), S244 (= S238), K245 (= K239), R252 (= R246)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
37% identity, 99% coverage: 3:396/396 of query aligns to 10:398/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G98), S105 (= S99), Q106 (= Q100), Y130 (≠ F124), V179 (≠ I168), N184 (= N173), D212 (= D201), P214 (= P203), Y215 (= Y204), T242 (≠ S236), S244 (= S238), K245 (= K239), R252 (= R246)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
42% identity, 99% coverage: 3:396/396 of query aligns to 7:382/389 of 2z1yA
- binding leucine: G32 (= G33), Y117 (≠ F124), R360 (= R374)
- binding pyridoxal-5'-phosphate: G91 (= G98), S92 (= S99), Q93 (= Q100), Y117 (≠ F124), N166 (= N173), D194 (= D201), Y197 (= Y204), S227 (= S236), S229 (= S238), K230 (= K239), R237 (= R246)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
38% identity, 99% coverage: 3:396/396 of query aligns to 7:396/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G98), S103 (= S99), Q104 (= Q100), Y128 (≠ F124), V177 (≠ I168), N182 (= N173), D210 (= D201), P212 (= P203), Y213 (= Y204), T240 (≠ S236), S242 (= S238), K243 (= K239), R250 (= R246)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
35% identity, 99% coverage: 3:394/396 of query aligns to 7:399/405 of 2zc0A
- active site: Y132 (≠ F124), D214 (= D201), A216 (≠ P203), S246 (= S238)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G98), G107 (≠ S99), T108 (≠ Q100), Y132 (≠ F124), N186 (= N173), D214 (= D201), A216 (≠ P203), Y217 (= Y204), T244 (≠ S236), S246 (= S238), K247 (= K239), R254 (= R246)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
34% identity, 98% coverage: 8:396/396 of query aligns to 21:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G98), S113 (= S99), Q114 (= Q100), Y138 (≠ F124), N194 (= N173), D222 (= D201), P224 (= P203), Y225 (= Y204), T252 (≠ S236), S254 (= S238), K255 (= K239), R262 (= R246)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
36% identity, 89% coverage: 26:378/396 of query aligns to 20:369/388 of 8tn3A
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
29% identity, 97% coverage: 13:396/396 of query aligns to 17:415/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), G34 (= G32), G35 (= G33), L36 (≠ F34), Y68 (= Y63), G110 (= G98), S111 (= S99), Q112 (= Q100), Y136 (≠ F124), N196 (= N173), D224 (= D201), P226 (= P203), Y227 (= Y204), S254 (= S236), S256 (= S238), K257 (= K239), R264 (= R246), R393 (= R374)
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 97% coverage: 13:396/396 of query aligns to 17:421/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G33), L40 (≠ F34), Y74 (= Y63), S117 (= S99), Q118 (= Q100), Y142 (≠ F124), N202 (= N173), D230 (= D201), P232 (= P203), Y233 (= Y204), S260 (= S236), S262 (= S238), K263 (= K239), R270 (= R246), R399 (= R374)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 97% coverage: 13:396/396 of query aligns to 17:421/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), R20 (= R16), T23 (≠ F19), G39 (= G33), L40 (≠ F34), Y74 (= Y63), S75 (≠ G64), S77 (≠ T66), S117 (= S99), Q118 (= Q100), Y142 (≠ F124), N202 (= N173), D230 (= D201), P232 (= P203), Y233 (= Y204), S260 (= S236), S262 (= S238), R270 (= R246), L293 (≠ A269), R399 (= R374)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 97% coverage: 13:396/396 of query aligns to 17:421/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), G39 (= G33), Y74 (= Y63), S75 (≠ G64), S77 (≠ T66), S117 (= S99), Q118 (= Q100), Y142 (≠ F124), N202 (= N173), D230 (= D201), P232 (= P203), Y233 (= Y204), S260 (= S236), S262 (= S238), R270 (= R246), L293 (≠ A269), R399 (= R374)
4gdyB Kynurenine aminotransferase ii inhibitors
30% identity, 97% coverage: 13:396/396 of query aligns to 17:421/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), M33 (≠ I27), G39 (= G33), Y74 (= Y63), S75 (≠ G64), G116 (= G98), S117 (= S99), Q118 (= Q100), Y142 (≠ F124), N202 (= N173), D230 (= D201), P232 (= P203), S260 (= S236), S262 (= S238), R270 (= R246), R399 (= R374)
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
30% identity, 97% coverage: 13:396/396 of query aligns to 20:424/428 of 6t8qA
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
30% identity, 94% coverage: 25:396/396 of query aligns to 20:410/414 of 2vgzA
Query Sequence
>Ac3H11_1015 Aromatic-amino-acid aminotransferase (EC 2.6.1.57)
MQFADRLNNVETSAIRELFKLLGKPGIISFAGGFPDSAMFDVEGIRAASNAALAEEPGAA
LQYGATEGYNPLREQLAAFMTSKGAKDVAADNLIVTTGSQQALDLLGKTLISPGDKVIVE
GPTFLATIQCFRLYGAELISAPIDGNGVKTDELEKLIAEHKPKFVYLIPTFGNPSGAMLS
LERRKAVLEMAVKHNTLIVEDDPYGDLYFGDAPPPSLLNLSATVPGSRELLVHCGSLSKV
LSPGLRVGWMIAPAELLGKATMCKQFSDAHTSTFAQATAAQYLKAGRMPGTLANVRKVYA
ERAQAMGDALRKELGDAIEFVQPQGGLFVWARLTGAGGKVADGNVLAKRAIEKGVAFVPG
TPFFCANPDHATFRLSFATADVDKIREGVARLGQAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory