Comparing Ac3H11_1076 FitnessBrowser__acidovorax_3H11:Ac3H11_1076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 72% coverage: 29:225/274 of query aligns to 21:219/375 of 2d62A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 86% coverage: 29:265/274 of query aligns to 20:247/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 86% coverage: 29:265/274 of query aligns to 20:247/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 86% coverage: 29:265/274 of query aligns to 20:247/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 86% coverage: 29:265/274 of query aligns to 20:247/353 of Q97UY8
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 69% coverage: 34:222/274 of query aligns to 46:236/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 69% coverage: 34:222/274 of query aligns to 46:236/382 of 7aheC
Sites not aligning to the query:
1g291 Malk (see paper)
33% identity, 78% coverage: 13:225/274 of query aligns to 8:216/372 of 1g291
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 69% coverage: 34:222/274 of query aligns to 46:236/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 72% coverage: 29:226/274 of query aligns to 16:220/240 of 4ymuJ
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
37% identity, 71% coverage: 28:221/274 of query aligns to 19:218/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 71% coverage: 28:221/274 of query aligns to 19:218/230 of 1l2tA
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
32% identity, 75% coverage: 17:221/274 of query aligns to 12:216/248 of 8g4cB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 69% coverage: 33:222/274 of query aligns to 36:221/378 of P69874
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
31% identity, 75% coverage: 17:221/274 of query aligns to 11:215/245 of 7tchB
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 71% coverage: 31:224/274 of query aligns to 21:216/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 71% coverage: 31:224/274 of query aligns to 21:216/263 of 7d08B
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 71% coverage: 31:224/274 of query aligns to 19:214/253 of 6z5uK
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 72% coverage: 29:224/274 of query aligns to 20:216/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 72% coverage: 29:224/274 of query aligns to 21:217/344 of 3tuzC
Sites not aligning to the query:
>Ac3H11_1076 FitnessBrowser__acidovorax_3H11:Ac3H11_1076
MQAADSYFVDFRDVWLAYNDELRAKNQFAVEAIDLQVRRGEFIAIVGPSGCGKSTFMKLA
TGLKMPSMGKILIDGQPVTGPLKVSGMAFQAPSLLPWRTTVDNVLLPLEIVEPYRSNFKQ
KRKEYEERARRLLQKVGLAGYEDKFPWQLSGGMQQRASICRALIHEPKMLLLDEPFGALD
AFTREELWCILRDLWTEQQFNVILVTHDLRESVFLADTVYVMSKSPGRFVVKKEIELPRP
RDLEITYTKEFTDIVHELRGHIGALRKSGAPIQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory